Statistics
| Revision:

root / branches / modelio3.6.x / src / main / conf / module.properties @ 240

History | View | Annotate | Download (72.9 KB)

1
ModuleLabel= Togaf Architect
2
ModuleDescription= Framework for Entreprise Architecture which provides a comprehensive approach to the design, planning, implementation, and governance of an enterprise information architecture. Version Open Source
3

    
4

    
5
CreateClassifier.label = Create a classifier from this instance
6
CreateClassifier.tooltip = Create a classifier from this instance
7
CreateClassifier.image =
8
CreateClassifier.group =
9
CreateClassifier.groupimage =
10
CreateClassifierByLifeline.label = Create a classifier from this instance
11
CreateClassifierByLifeline.tooltip = Create a classifier from this instance
12
CreateClassifierByLifeline.image =
13
CreateClassifierByLifeline.group =
14
CreateClassifierByLifeline.groupimage =
15
UpdateFromClassifier.label = Update instance or part from an existing classifier
16
UpdateFromClassifier.tooltip = Update instance or part from an existing classifier
17
UpdateFromClassifier.image =
18
UpdateFromClassifier.group =
19
UpdateFromClassifier.groupimage =
20
UpdateFromClassifierByLifeline.label = Update instance or part from an existing classifier
21
UpdateFromClassifierByLifeline.tooltip = Update instance or part from an existing classifier
22
UpdateFromClassifierByLifeline.image =
23
UpdateFromClassifierByLifeline.group =
24
UpdateFromClassifierByLifeline.groupimage =
25
CreateOperation.label = Create an operation from this message
26
CreateOperation.tooltip = Create an operation from this message
27
CreateOperation.image =
28
CreateOperation.group =
29
CreateOperation.groupimage =
30
CreateOperationFromTransition.label = Create an operation from this transition
31
CreateOperationFromTransition.tooltip = Create an operation from this transition
32
CreateOperationFromTransition.image =
33
CreateOperationFromTransition.group =
34
CreateOperationFromTransition.groupimage =
35
CreateAttribute.label = Create an attribute from this occurence
36
CreateAttribute.tooltip = Create an attribute from this occurence
37
CreateAttribute.image =
38
CreateAttribute.group =
39
CreateAttribute.groupimage =
40
UpdateClassesFromInterface.label = Update classes from this interface
41
UpdateClassesFromInterface.tooltip = Update classes from this interface
42
UpdateClassesFromInterface.image =
43
UpdateClassesFromInterface.group =
44
UpdateClassesFromInterface.groupimage =
45
ImplementInterfaces.label = Implement interfaces properties
46
ImplementInterfaces.tooltip = Implement interfaces properties
47
ImplementInterfaces.image =
48
ImplementInterfaces.group =
49
ImplementInterfaces.groupimage =
50
UnimplementInterfaces.label = Delete interface properties implementations
51
UnimplementInterfaces.tooltip = Delete interface properties implementations
52
UnimplementInterfaces.image =
53
UnimplementInterfaces.group =
54
UnimplementInterfaces.groupimage =
55
UpdateInternalStructure.label = Update internal structure
56
UpdateInternalStructure.tooltip = Update internal structure
57
UpdateInternalStructure.image =
58
UpdateInternalStructure.group =
59
UpdateInternalStructure.groupimage =
60
CreateStateMachineFromState.label = Create a state machine from this state
61
CreateStateMachineFromState.tooltip = Create a state machine from this state
62
CreateStateMachineFromState.image =
63
CreateStateMachineFromState.group =
64
CreateStateMachineFromState.groupimage =
65
UpdateStateFromStateMachine.label = Update state from an existing state machine
66
UpdateStateFromStateMachine.tooltip = Update state from an existing state machine
67
UpdateStateFromStateMachine.image =
68
UpdateStateFromStateMachine.group =
69
UpdateStateFromStateMachine.groupimage =
70
OpenDocument.label = Open
71
OpenDocument.tooltip = Open
72
OpenDocument.image =
73
OpenDocument.group =
74
OpenDocument.groupimage =
75
Directory.label = Directory
76
Directory.tooltip = Create a directory
77
Directory.image =
78
Directory.group =
79
Directory.groupimage =
80
Directory.label = Directory
81
Directory.tooltip = Create a directory
82
Directory.image =
83
Directory.group =
84
Directory.groupimage =
85
File.label = File
86
File.tooltip = Create a file
87
File.image =
88
File.group =
89
File.groupimage =
90
File.label = File
91
File.tooltip = Create a file
92
File.image =
93
File.group =
94
File.groupimage =
95
Mailadress.label = Mail address
96
Mailadress.tooltip = Create a mail address
97
Mailadress.image =
98
Mailadress.group =
99
Mailadress.groupimage =
100
Url.label = Url
101
Url.tooltip = Create an url
102
Url.image =
103
Url.group =
104
Url.groupimage =
105
BusinessLayer.label = Business Layer
106
BusinessLayer.tooltip = Business Layer
107
BusinessLayer.image = res/bmp/profile/businesslayer16.png
108
BusinessLayer.group =
109
BusinessLayer.groupimage =
110
ApplicationLayer.label = Application Layer
111
ApplicationLayer.tooltip = Application Layer
112
ApplicationLayer.image = res/bmp/profile/applicationlayer16.png
113
ApplicationLayer.group =
114
ApplicationLayer.groupimage =
115
BusinessEntities.label = Business Entities
116
BusinessEntities.tooltip = Business Entities
117
BusinessEntities.image = res/bmp/profile/businessentity16.png
118
BusinessEntities.group =
119
BusinessEntities.groupimage =
120
DataArchitecture.label = Data Architecture
121
DataArchitecture.tooltip = Data Architecture
122
DataArchitecture.image = res/bmp/profile/dataarchitecture16.png
123
DataArchitecture.group =
124
DataArchitecture.groupimage =
125
ApplicationArchitecture.label = Application Architecture
126
ApplicationArchitecture.tooltip = Application Architecture
127
ApplicationArchitecture.image = res/bmp/profile/applicationarchitecture16.png
128
ApplicationArchitecture.group =
129
ApplicationArchitecture.groupimage =
130
BusinessArchitecture.label = Business Architecture
131
BusinessArchitecture.tooltip = Business Architecture
132
BusinessArchitecture.image = res/bmp/profile/businessarchitecture16.png
133
BusinessArchitecture.group =
134
BusinessArchitecture.groupimage =
135
TechnologyArchitecture.label = Technology Architecture
136
TechnologyArchitecture.tooltip = Technology Architecture
137
TechnologyArchitecture.image = res/bmp/profile/technologylayer16.png
138
TechnologyArchitecture.group =
139
TechnologyArchitecture.groupimage =
140
Interaction.label = Interaction
141
Interaction.tooltip = Interaction
142
Interaction.image =
143
Interaction.group =
144
Interaction.groupimage =
145
CommunicationInteraction.label = Communication Interaction
146
CommunicationInteraction.tooltip = Communication Interaction
147
CommunicationInteraction.image =
148
CommunicationInteraction.group =
149
CommunicationInteraction.groupimage =
150
BPMNBehavior.label = BPMN Behavior
151
BPMNBehavior.tooltip = BPMN Behavior
152
BPMNBehavior.image =
153
BPMNBehavior.group =
154
BPMNBehavior.groupimage =
155
TechnologyDomain.label = Technology Domain
156
TechnologyDomain.tooltip = Technology Domain
157
TechnologyDomain.image = res/bmp/profile/technologydomain16.png
158
TechnologyDomain.group =
159
TechnologyDomain.groupimage =
160
Server.label = Server
161
Server.tooltip = Server
162
Server.image = res/bmp/profile/server16.png
163
Server.group = Device
164
Server.groupimage = res/bmp/profile/internet16.png
165
Workstation.label = Workstation
166
Workstation.tooltip = Workstation
167
Workstation.image = res/bmp/profile/workstation16.png
168
Workstation.group = Device
169
Workstation.groupimage =
170
Internet.label = Internet
171
Internet.tooltip = Internet
172
Internet.image = res/bmp/profile/internet16.png
173
Internet.group = Device
174
Internet.groupimage = res/bmp/profile/internet16.png
175
Router.label = Router
176
Router.tooltip = Router
177
Router.image = res/bmp/profile/router16.png
178
Router.group = Device
179
Router.groupimage = res/bmp/profile/internet16.png
180
Switch.label = Switch
181
Switch.tooltip = Switch
182
Switch.image = res/bmp/profile/switch16.png
183
Switch.group = Device
184
Switch.groupimage = res/bmp/profile/internet16.png
185
NetworkNode.label = Network Node
186
NetworkNode.tooltip = Network Node
187
NetworkNode.image = res/bmp/profile/networknode16.png
188
NetworkNode.group = Device
189
NetworkNode.groupimage = res/bmp/profile/internet16.png
190
TechnologyArtifact.label = Technology Artifact
191
TechnologyArtifact.tooltip = Technology Artifact
192
TechnologyArtifact.image = res/bmp/profile/artifact16.png
193
TechnologyArtifact.group =
194
TechnologyArtifact.groupimage =
195
OrganizationDomain.label = Organization Domain
196
OrganizationDomain.tooltip = Organization Domain
197
OrganizationDomain.image = res/bmp/profile/organizationsdomain16.png
198
OrganizationDomain.group = Organization
199
OrganizationDomain.groupimage = res/bmp/profile/organizationsdomain16.png
200
OrganizationUnit.label = Organization Unit
201
OrganizationUnit.tooltip = Organization Unit
202
OrganizationUnit.image = res/bmp/profile/organizationsunit16.png
203
OrganizationUnit.group = Organization
204
OrganizationUnit.groupimage =
205
ExternalActor.label = External Actor
206
ExternalActor.tooltip = External Actor
207
ExternalActor.image = res/bmp/profile/externalactor16.png
208
ExternalActor.group = Participant
209
ExternalActor.groupimage = res/bmp/profile/externalactor16.png
210
InternalActor.label = Internal Actor
211
InternalActor.tooltip = Internal Actor
212
InternalActor.image = res/bmp/profile/internalactor16.png
213
InternalActor.group = Participant
214
InternalActor.groupimage = res/bmp/profile/externalactor16.png
215
ExternalRole.label = External Role
216
ExternalRole.tooltip = External Role
217
ExternalRole.image = res/bmp/profile/externalrole16.png
218
ExternalRole.group = Participant
219
ExternalRole.groupimage = res/bmp/profile/externalactor16.png
220
InternalRole.label = Internal Role
221
InternalRole.tooltip = Internal Role
222
InternalRole.image = res/bmp/profile/internalrole16.png
223
InternalRole.group = Participant
224
InternalRole.groupimage = res/bmp/profile/externalactor16.png
225
Event.label = Event
226
Event.tooltip = Event
227
Event.image = res/bmp/profile/event16.png
228
Event.group =
229
Event.groupimage =
230
BusinessProcess.label = Business Process
231
BusinessProcess.tooltip = Business Process
232
BusinessProcess.image = res/bmp/profile/togafprocess16.png
233
BusinessProcess.group =
234
BusinessProcess.groupimage =
235
BusinessCollaboration.label = Business Collaboration
236
BusinessCollaboration.tooltip = Business Collaboration
237
BusinessCollaboration.image = res/bmp/profile/businesscollaboration16.png
238
BusinessCollaboration.group =
239
BusinessCollaboration.groupimage =
240
BusinessService.label = Business Service
241
BusinessService.tooltip = Business Service
242
BusinessService.image = res/bmp/profile/businessservice16.png
243
BusinessService.group =
244
BusinessService.groupimage =
245
ISService.label = IS Service
246
ISService.tooltip = IS Service
247
ISService.image = res/bmp/profile/isservice16.png
248
ISService.group =
249
ISService.groupimage =
250
Function.label = Function
251
Function.tooltip = Function
252
Function.image = res/bmp/profile/functionservice16.png
253
Function.group =
254
Function.groupimage =
255
Product.label = Product
256
Product.tooltip = Product
257
Product.image = res/bmp/profile/togafproduct16.png
258
Product.group =
259
Product.groupimage =
260
BusinessCapability.label = Business Capability
261
BusinessCapability.tooltip = Business Capability
262
BusinessCapability.image = res/bmp/profile/businesscapabilityservice16.png
263
BusinessCapability.group =
264
BusinessCapability.groupimage =
265
Operation.label = Operation
266
Operation.tooltip = Operation
267
Operation.image = res/bmp/profile/businessserviceoperation16.png
268
Operation.group =
269
Operation.groupimage =
270
ISServiceOperation.label = IS Service Operation
271
ISServiceOperation.tooltip = IS Service Operation
272
ISServiceOperation.image = res/bmp/profile/isserviceoperation16.png
273
ISServiceOperation.group =
274
ISServiceOperation.groupimage =
275
Location.label = Location
276
Location.tooltip = Location
277
Location.image = res/bmp/profile/location16.png
278
Location.group = Location
279
Location.groupimage = res/bmp/profile/location16.png
280
Headquarter.label = Headquarter
281
Headquarter.tooltip = Headquarter
282
Headquarter.image = res/bmp/profile/headquarterlocation16.png
283
Headquarter.group = Location
284
Headquarter.groupimage = res/bmp/profile/location16.png
285
ServiceContract.label = Service Contract
286
ServiceContract.tooltip = Service Contract
287
ServiceContract.image = res/bmp/profile/servicecontract16.png
288
ServiceContract.group =
289
ServiceContract.groupimage =
290
ApplicationDomain.label = Application Domain
291
ApplicationDomain.tooltip = Application Domain
292
ApplicationDomain.image = res/bmp/profile/applicationdomain16.png
293
ApplicationDomain.group =
294
ApplicationDomain.groupimage =
295
System.label = System
296
System.tooltip = System
297
System.image = res/bmp/profile/system16.png
298
System.group = System/Application
299
System.groupimage = res/bmp/profile/system16.png
300
SystemFederation.label = System Federation
301
SystemFederation.tooltip = System Federation
302
SystemFederation.image = res/bmp/profile/systemfederation16.png
303
SystemFederation.group = System/Application
304
SystemFederation.groupimage = res/bmp/profile/system16.png
305
EnterpriseSystem.label = Enterprise System
306
EnterpriseSystem.tooltip = Enterprise System
307
EnterpriseSystem.image = res/bmp/profile/enterprisesystem16.png
308
EnterpriseSystem.group = System/Application
309
EnterpriseSystem.groupimage = res/bmp/profile/system16.png
310
Application.label = Application
311
Application.tooltip = Application
312
Application.image = res/bmp/profile/application16.png
313
Application.group = System/Application
314
Application.groupimage = res/bmp/profile/system16.png
315
ServiceComponent.label = Service Component
316
ServiceComponent.tooltip = Service Component
317
ServiceComponent.image = res/bmp/profile/applicationcomponent16.png
318
ServiceComponent.group = Service Component
319
ServiceComponent.groupimage = res/bmp/profile/applicationcomponent16.png
320
InteractionComponent.label = Interaction Component
321
InteractionComponent.tooltip = Interaction Component
322
InteractionComponent.image = res/bmp/profile/interactioncomponent16.png
323
InteractionComponent.group = Service Component
324
InteractionComponent.groupimage = res/bmp/profile/applicationcomponent16.png
325
ProcessComponent.label = Process Component
326
ProcessComponent.tooltip = Process Component
327
ProcessComponent.image = res/bmp/profile/processcomponent16.png
328
ProcessComponent.group = Service Component
329
ProcessComponent.groupimage = res/bmp/profile/applicationcomponent16.png
330
IntermediaryComponent.label = Intermediary Component
331
IntermediaryComponent.tooltip = Intermediary Component
332
IntermediaryComponent.image = res/bmp/profile/intermediarycomponent16.png
333
IntermediaryComponent.group = Service Component
334
IntermediaryComponent.groupimage = res/bmp/profile/applicationcomponent16.png
335
PublicComponent.label = Public Component
336
PublicComponent.tooltip = Public Component
337
PublicComponent.image = res/bmp/profile/publiccomponent16.png
338
PublicComponent.group = Service Component
339
PublicComponent.groupimage = res/bmp/profile/applicationcomponent16.png
340
UtilityComponent.label = Utility Component
341
UtilityComponent.tooltip = Utility Component
342
UtilityComponent.image = res/bmp/profile/utilitycomponent16.png
343
UtilityComponent.group = Service Component
344
UtilityComponent.groupimage = res/bmp/profile/applicationcomponent16.png
345
EntityComponent.label = Entity Component
346
EntityComponent.tooltip = Entity Component
347
EntityComponent.image = res/bmp/profile/entitycomponent16.png
348
EntityComponent.group = Service Component
349
EntityComponent.groupimage = res/bmp/profile/applicationcomponent16.png
350
Database.label = Database
351
Database.tooltip = Database
352
Database.image = res/bmp/profile/databaseapplicationcomponent16.png
353
Database.group = Service Component
354
Database.groupimage = res/bmp/profile/applicationcomponent16.png
355
ApplicationCollaboration.label = Application Collaboration
356
ApplicationCollaboration.tooltip = Application Collaboration
357
ApplicationCollaboration.image = res/bmp/profile/applicationcollaboration16.png
358
ApplicationCollaboration.group =
359
ApplicationCollaboration.groupimage =
360
ApplicationInstance.label = Application Instance
361
ApplicationInstance.tooltip = Application Instance
362
ApplicationInstance.image = res/bmp/profile/applicationcomponentinstance16.png
363
ApplicationInstance.group =
364
ApplicationInstance.groupimage =
365
Message.label = Message
366
Message.tooltip = Message
367
Message.image = res/bmp/profile/servicedata16.png
368
Message.group =
369
Message.groupimage =
370
MessageFragment.label = Message Fragment
371
MessageFragment.tooltip = Message Fragment
372
MessageFragment.image = res/bmp/profile/servicedatafragment16.png
373
MessageFragment.group =
374
MessageFragment.groupimage =
375
ApplicationAttribute.label = Application Attribute
376
ApplicationAttribute.tooltip = Application Attribute
377
ApplicationAttribute.image = res/bmp/profile/businessattribute16.png
378
ApplicationAttribute.group =
379
ApplicationAttribute.groupimage =
380
ApplicationOperation.label = Application Operation
381
ApplicationOperation.tooltip = Application Operation
382
ApplicationOperation.image = res/bmp/profile/businessoperation16.png
383
ApplicationOperation.group =
384
ApplicationOperation.groupimage =
385
Provided.label = Provided
386
Provided.tooltip = Provided
387
Provided.image = res/bmp/profile/serviceaccessprovide16.png
388
Provided.group =
389
Provided.groupimage =
390
Required.label = Required
391
Required.tooltip = Required
392
Required.image = res/bmp/profile/serviceaccessrequired16.png
393
Required.group =
394
Required.groupimage =
395
InformationDomain.label = Information Domain
396
InformationDomain.tooltip = Information Domain
397
InformationDomain.image = res/bmp/profile/businessdomain16.png
398
InformationDomain.group =
399
InformationDomain.groupimage =
400
BusinessEntity.label = Business Entity
401
BusinessEntity.tooltip = Business Entity
402
BusinessEntity.image = res/bmp/profile/businessentitys16.png
403
BusinessEntity.group =
404
BusinessEntity.groupimage =
405
Attribute.label = Attribute
406
Attribute.tooltip = Attribute
407
Attribute.image = res/bmp/profile/businessattribute16.png
408
Attribute.group =
409
Attribute.groupimage =
410
Operation.label = Operation
411
Operation.tooltip = Operation
412
Operation.image = res/bmp/profile/businessoperation16.png
413
Operation.group =
414
Operation.groupimage =
415
Enumeration.label = Enumeration
416
Enumeration.tooltip = Enumeration
417
Enumeration.image = res/bmp/profile/businessenumeration16.png
418
Enumeration.group =
419
Enumeration.groupimage =
420
EnumerationLiteral.label = Enumeration Literal
421
EnumerationLiteral.tooltip = Enumeration Literal
422
EnumerationLiteral.image = res/bmp/modelio/umlenumerationlitteral.png
423
EnumerationLiteral.group =
424
EnumerationLiteral.groupimage =
425
BusinessDataType.label = Business Data Type
426
BusinessDataType.tooltip = Business Data Type
427
BusinessDataType.image = res/bmp/profile/businessdatatype16.png
428
BusinessDataType.group =
429
BusinessDataType.groupimage =
430
Lifecycle.label = Lifecycle
431
Lifecycle.tooltip = Lifecycle
432
Lifecycle.image = res/bmp/profile/entitylifecycle16.png
433
Lifecycle.group =
434
Lifecycle.groupimage =
435
Precondition.label = Precondition
436
Precondition.tooltip = Precondition
437
Precondition.image = res/bmp/profile/precondition16.png
438
Precondition.group =
439
Precondition.groupimage =
440
Postcondition.label = Postcondition
441
Postcondition.tooltip = Postcondition
442
Postcondition.image = res/bmp/profile/postcondition16.png
443
Postcondition.group =
444
Postcondition.groupimage =
445
Invariant.label = Invariant
446
Invariant.tooltip = Invariant
447
Invariant.image = res/bmp/profile/invariant16.png
448
Invariant.group =
449
Invariant.groupimage =
450
BusinessToExchangeDataTransformation.label = Message generation from Business Entities
451
BusinessToExchangeDataTransformation.tooltip = Message generation from Business Entities
452
BusinessToExchangeDataTransformation.image = res/bmp/exchangedatacommande16.png
453
BusinessToExchangeDataTransformation.group = Model transformation
454
BusinessToExchangeDataTransformation.groupimage = res/bmp/exchangedatacommande16.png
455
BusinessToPersistantTransformation.label = Data Model generation from Business Entities
456
BusinessToPersistantTransformation.tooltip = Data Model generation from Business Entities
457
BusinessToPersistantTransformation.image = res/bmp/businessentityscommande16.png
458
BusinessToPersistantTransformation.group = Model transformation
459
BusinessToPersistantTransformation.groupimage = res/bmp/exchangedatacommande16.png
460
ArchitectureToJavaTransformation.label = Transformation of Architecture model to Java implementation
461
ArchitectureToJavaTransformation.tooltip = Model transformation
462
ArchitectureToJavaTransformation.image = res/bmp/javacommande16.png
463
ArchitectureToJavaTransformation.group = Model transformation
464
ArchitectureToJavaTransformation.groupimage = res/bmp/exchangedatacommande16.png
465
ProductBusinessInteractionMatrix.label = Business - Interaction Matrix
466
ProductBusinessInteractionMatrix.tooltip = Business - Interaction Matrix
467
ProductBusinessInteractionMatrix.image = res/bmp/matrix16.png
468
ProductBusinessInteractionMatrix.group = Document production|Matrices
469
ProductBusinessInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
470
ProductActorRoleMatrix.label = Actor - Role Matrix
471
ProductActorRoleMatrix.tooltip = Actor - Role Matrix
472
ProductActorRoleMatrix.image = res/bmp/matrix16.png
473
ProductActorRoleMatrix.group = Document production|Matrices
474
ProductActorRoleMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
475
ProductDataEntityBusinessFunctionMatrix.label = Data Entity - Business Function Matrix
476
ProductDataEntityBusinessFunctionMatrix.tooltip = Data Entity - Business Function Matrix
477
ProductDataEntityBusinessFunctionMatrix.image = res/bmp/matrix16.png
478
ProductDataEntityBusinessFunctionMatrix.group = Document production|Matrices
479
ProductDataEntityBusinessFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
480
ProductSystemDataMatrix.label = Product - System - Data Matrix
481
ProductSystemDataMatrix.tooltip = Product - System - Data Matrix
482
ProductSystemDataMatrix.image = res/bmp/matrix16.png
483
ProductSystemDataMatrix.group = Document production|Matrices
484
ProductSystemDataMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
485
ProductSystemOrganizationMatrix.label = System - Organization Matrix
486
ProductSystemOrganizationMatrix.tooltip = Label=System - Organization Matrix
487
ProductSystemOrganizationMatrix.image = res/bmp/matrix16.png
488
ProductSystemOrganizationMatrix.group = Document production|Matrices
489
ProductSystemOrganizationMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
490
ProductRoleSystemMatrix.label = Role - System Matrix
491
ProductRoleSystemMatrix.tooltip = Role - System Matrix
492
ProductRoleSystemMatrix.image = res/bmp/matrix16.png
493
ProductRoleSystemMatrix.group = Document production|Matrices
494
ProductRoleSystemMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
495
ProductSystemFunctionMatrix.label = System - Function Matrix
496
ProductSystemFunctionMatrix.tooltip = System - Function Matrix
497
ProductSystemFunctionMatrix.image = res/bmp/matrix16.png
498
ProductSystemFunctionMatrix.group = Document production|Matrices
499
ProductSystemFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
500
ProductApplicationInteractionMatrix.label = Application - Interaction Matrix
501
ProductApplicationInteractionMatrix.tooltip = Application - Interaction Matrix
502
ProductApplicationInteractionMatrix.image = res/bmp/matrix16.png
503
ProductApplicationInteractionMatrix.group = Document production|Matrices
504
ProductApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
505
ProductOrganizationCatalog.label = Organization Catalog
506
ProductOrganizationCatalog.tooltip = Organization Catalog
507
ProductOrganizationCatalog.image = res/bmp/catalog16.png
508
ProductOrganizationCatalog.group = Document production|Catalogs
509
ProductOrganizationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
510
ProductRoleCatalog.label = Role - Actor Catalog
511
ProductRoleCatalog.tooltip = Role - Actor Catalog
512
ProductRoleCatalog.image = res/bmp/catalog16.png
513
ProductRoleCatalog.group = Document production|Catalogs
514
ProductRoleCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
515
ProductGoalCatalog.label = Driver - Goal - Objective Catalog
516
ProductGoalCatalog.tooltip = Driver - Goal - Objective Catalog
517
ProductGoalCatalog.image = res/bmp/catalog16.png
518
ProductGoalCatalog.group = Document production|Catalogs
519
ProductGoalCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
520
ProductBusinessCatalog.label = BusinessService - Function Catalog
521
ProductBusinessCatalog.tooltip = Business Service - Function Catalog
522
ProductBusinessCatalog.image = res/bmp/catalog16.png
523
ProductBusinessCatalog.group = Document production|Catalogs
524
ProductBusinessCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
525
ProductLocationCatalog.label = Location Catalog
526
ProductLocationCatalog.tooltip = Location Catalog
527
ProductLocationCatalog.image = res/bmp/catalog16.png
528
ProductLocationCatalog.group = Document production|Catalogs
529
ProductLocationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
530
ProductProcessEventControlProductCatalog.label = Process - Event - Control - Product Catalog
531
ProductProcessEventControlProductCatalog.tooltip = Process - Event - Control - Product Catalog
532
ProductProcessEventControlProductCatalog.image = res/bmp/catalog16.png
533
ProductProcessEventControlProductCatalog.group = Document production|Catalogs
534
ProductProcessEventControlProductCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
535
BusinessEntityCatalog.label = Business Entities Catalog
536
BusinessEntityCatalog.tooltip = Business Entities Catalog
537
BusinessEntityCatalog.image = res/bmp/extensioncatalog16.png
538
BusinessEntityCatalog.group = Document production|Catalogs (Modelio)
539
BusinessEntityCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
540
UseCasesCatalog.label = Use Cases Catalog
541
UseCasesCatalog.tooltip = Use Cases Catalog
542
UseCasesCatalog.image = res/bmp/extensioncatalog16.png
543
UseCasesCatalog.group = Document production|Catalogs (Modelio)
544
UseCasesCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
545
InformationServiceCatalog.label = Information Service Catalog
546
InformationServiceCatalog.tooltip = Information Service Catalog
547
InformationServiceCatalog.image = res/bmp/extensioncatalog16.png
548
InformationServiceCatalog.group = Document production|Catalogs (Modelio)
549
InformationServiceCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
550
ComponentCatalog.label = Component Catalog
551
ComponentCatalog.tooltip = Component Catalog
552
ComponentCatalog.image = res/bmp/extensioncatalog16.png
553
ComponentCatalog.group = Document production|Catalogs (Modelio)
554
ComponentCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
555
ServiceDataCatalog.label = Service Data Catalog
556
ServiceDataCatalog.tooltip = Service Data Catalog
557
ServiceDataCatalog.image = res/bmp/extensioncatalog16.png
558
ServiceDataCatalog.group = Document production|Catalogs (Modelio)
559
ServiceDataCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
560
CreateBusinessInteractionMatrix.label = Business - Interaction Matrix
561
CreateBusinessInteractionMatrix.tooltip = Create Business - Interaction Matrix
562
CreateBusinessInteractionMatrix.image = res/bmp/staticmatrix16.png
563
CreateBusinessInteractionMatrix.group = Traceability Matrices
564
CreateBusinessInteractionMatrix.groupimage = res/bmp/staticmatrix16.png
565
CreateActorRoleMatrix.label = Actor - Role Matrix
566
CreateActorRoleMatrix.tooltip = Create Actor - Role Matrix
567
CreateActorRoleMatrix.image = res/bmp/staticmatrix16.png
568
CreateActorRoleMatrix.group = Traceability Matrices
569
CreateActorRoleMatrix.groupimage = res/bmp/staticmatrix16.png
570
CreateDataEntityBusinessFunctionMatrix.label = DataEntity - BusinessFunction Matrix
571
CreateDataEntityBusinessFunctionMatrix.tooltip = Create DataEntity - BusinessFunction Matrix
572
CreateDataEntityBusinessFunctionMatrix.image = res/bmp/staticmatrix16.png
573
CreateDataEntityBusinessFunctionMatrix.group = Traceability Matrices
574
CreateDataEntityBusinessFunctionMatrix.groupimage = res/bmp/staticmatrix16.png
575
CreateSystemDataMatrix.label = System - Data Matrix
576
CreateSystemDataMatrix.tooltip = Create System - Data Matrix
577
CreateSystemDataMatrix.image = res/bmp/staticmatrix16.png
578
CreateSystemDataMatrix.group = Traceability Matrices
579
CreateSystemDataMatrix.groupimage = res/bmp/staticmatrix16.png
580
CreateSystemOrganizationMatrix.label = System - Organization Matrix
581
CreateSystemOrganizationMatrix.tooltip = Create System - Organization Matrix
582
CreateSystemOrganizationMatrix.image = res/bmp/staticmatrix16.png
583
CreateSystemOrganizationMatrix.group = Traceability Matrices
584
CreateSystemOrganizationMatrix.groupimage = res/bmp/staticmatrix16.png
585
CreateRoleSystemMatrix.label = Role - System Matrix
586
CreateRoleSystemMatrix.tooltip = Create Role - System Matrix
587
CreateRoleSystemMatrix.image = res/bmp/staticmatrix16.png
588
CreateRoleSystemMatrix.group = Traceability Matrices
589
CreateRoleSystemMatrix.groupimage = res/bmp/staticmatrix16.png
590
CreateSystemFunctionMatrix.label = System - Function Matrix
591
CreateSystemFunctionMatrix.tooltip = Create System - Function Matrix
592
CreateSystemFunctionMatrix.image = res/bmp/staticmatrix16.png
593
CreateSystemFunctionMatrix.group = Traceability Matrices
594
CreateSystemFunctionMatrix.groupimage = res/bmp/staticmatrix16.png
595
CreateApplicationInteractionMatrix.label = Application - Interaction Matrix
596
CreateApplicationInteractionMatrix.tooltip = Create Application - Interaction Matrix
597
CreateApplicationInteractionMatrix.image = res/bmp/staticmatrix16.png
598
CreateApplicationInteractionMatrix.group = Traceability Matrices
599
CreateApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png
600

    
601

    
602
TechnologyArchitectureDomainDiagramCommande.label = Technology Domain
603
TechnologyArchitectureDomainDiagramCommande.tooltip = Technology Domain
604
TechnologyArchitectureDomainDiagramCommande.image = res/bmp/profile/technologydomain16.png
605
DeploymentServerDiagramCommande.label = Server
606
DeploymentServerDiagramCommande.tooltip = Server
607
DeploymentServerDiagramCommande.image = res/bmp/profile/server16.png
608
DeploymentWorkStationDiagramCommande.label = Workstation
609
DeploymentWorkStationDiagramCommande.tooltip = Workstation
610
DeploymentWorkStationDiagramCommande.image = res/bmp/profile/workstation16.png
611
DeploymentInternetDiagramCommande.label = Internet
612
DeploymentInternetDiagramCommande.tooltip = Internet
613
DeploymentInternetDiagramCommande.image = res/bmp/profile/internet16.png
614
DeploymentRouterDiagramCommande.label = Router
615
DeploymentRouterDiagramCommande.tooltip = Router
616
DeploymentRouterDiagramCommande.image = res/bmp/profile/router16.png
617
DeploymentSwitchDiagramCommande.label = Switch
618
DeploymentSwitchDiagramCommande.tooltip = Switch
619
DeploymentSwitchDiagramCommande.image = res/bmp/profile/switch16.png
620
DeploymentNetworkNodeDiagramCommande.label = Network Node
621
DeploymentNetworkNodeDiagramCommande.tooltip = Network Node
622
DeploymentNetworkNodeDiagramCommande.image = res/bmp/profile/networknode16.png
623
BusinessOrganizationDomainDiagramCommande.label = Organization Domain
624
BusinessOrganizationDomainDiagramCommande.tooltip = Organization Domain
625
BusinessOrganizationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png
626
TogafExternalActorDiagramCommande.label = External Actor
627
TogafExternalActorDiagramCommande.tooltip = External Actor
628
TogafExternalActorDiagramCommande.image = res/bmp/profile/externalactor16.png
629
TogafInternalActorDiagramCommande.label = Internal Actor
630
TogafInternalActorDiagramCommande.tooltip = Internal Actor
631
TogafInternalActorDiagramCommande.image = res/bmp/profile/internalactor16.png
632
TogafExternalRoleDiagramCommande.label = External Role
633
TogafExternalRoleDiagramCommande.tooltip = External Role
634
TogafExternalRoleDiagramCommande.image = res/bmp/profile/externalrole16.png
635
TogafInternalRoleDiagramCommande.label = Internal Role
636
TogafInternalRoleDiagramCommande.tooltip = Internal Role
637
TogafInternalRoleDiagramCommande.image = res/bmp/profile/internalrole16.png
638
EventDiagramCommande.label = Event
639
EventDiagramCommande.tooltip = Event
640
EventDiagramCommande.image = res/bmp/profile/event16.png
641
TogafOrganizationUnitDiagramCommande.label = Organization Unit
642
TogafOrganizationUnitDiagramCommande.tooltip = Organization Unit
643
TogafOrganizationUnitDiagramCommande.image = res/bmp/profile/organizationsunit16.png
644
TogafProcessDiagramCommande.label = Business Process
645
TogafProcessDiagramCommande.tooltip = Business Process
646
TogafProcessDiagramCommande.image = res/bmp/profile/togafprocess16.png
647
TogafBusinessCollaborationDiagramCommande.label = Business Collaboration
648
TogafBusinessCollaborationDiagramCommande.tooltip = Business Collaboration
649
TogafBusinessCollaborationDiagramCommande.image = res/bmp/profile/businesscollaboration16.png
650
TogafFunctionDiagramCommande.label = Function
651
TogafFunctionDiagramCommande.tooltip = Function
652
TogafFunctionDiagramCommande.image = res/bmp/profile/functionservice16.png
653
TogafBusinessServiceDiagramCommande.label = Business Service
654
TogafBusinessServiceDiagramCommande.tooltip = Business Service
655
TogafBusinessServiceDiagramCommande.image = res/bmp/profile/businessservice16.png
656
TogafBusinessCapabilityDiagramCommande.label = Business Capability
657
TogafBusinessCapabilityDiagramCommande.tooltip = Business Capability
658
TogafBusinessCapabilityDiagramCommande.image = res/bmp/profile/businesscapabilityservice16.png
659
TogafBusinessOperationDiagramCommande.label = Operation
660
TogafBusinessOperationDiagramCommande.tooltip = Operation
661
TogafBusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
662
TogafProductDiagramCommande.label = Product
663
TogafProductDiagramCommande.tooltip = Product
664
TogafProductDiagramCommande.image = res/bmp/profile/togafproduct16.png
665
LocationDiagramCommande.label = Location
666
LocationDiagramCommande.tooltip = Location
667
LocationDiagramCommande.image = res/bmp/profile/location16.png
668
HeadquarterLocationDiagramCommande.label = Headquarter
669
HeadquarterLocationDiagramCommande.tooltip = Headquarter
670
HeadquarterLocationDiagramCommande.image = res/bmp/profile/headquarterlocation16.png
671
TogafServiceContractDiagramCommande.label = Service Contract
672
TogafServiceContractDiagramCommande.tooltip = Service Contract
673
TogafServiceContractDiagramCommande.image = res/bmp/profile/servicecontract16.png
674
SystemApplicationComponentDiagramCommande.label = System
675
SystemApplicationComponentDiagramCommande.tooltip = System
676
SystemApplicationComponentDiagramCommande.image = res/bmp/profile/system16.png
677
TogafSystemFederationDiagramCommande.label = System Federation
678
TogafSystemFederationDiagramCommande.tooltip = System Federation
679
TogafSystemFederationDiagramCommande.image = res/bmp/profile/systemfederation16.png
680
TogafEnterpriseSystemDiagramCommande.label = Enterprise System
681
TogafEnterpriseSystemDiagramCommande.tooltip = Enterprise System
682
TogafEnterpriseSystemDiagramCommande.image = res/bmp/profile/enterprisesystem16.png
683
TogafApplicationDiagramCommande.label = Application
684
TogafApplicationDiagramCommande.tooltip = Application
685
TogafApplicationDiagramCommande.image = res/bmp/profile/application16.png
686
ServiceApplicationComponentDiagramCommande.label = Service Component
687
ServiceApplicationComponentDiagramCommande.tooltip = Service Component
688
ServiceApplicationComponentDiagramCommande.image = res/bmp/profile/applicationcomponent16.png
689
InteractionApplicationComponentDiagramCommande.label = Interaction Component
690
InteractionApplicationComponentDiagramCommande.tooltip = Interaction Component
691
InteractionApplicationComponentDiagramCommande.image = res/bmp/profile/interactioncomponent16.png
692
ProcessApplicationComponentDiagramCommande.label = Process Component
693
ProcessApplicationComponentDiagramCommande.tooltip = Process Component
694
ProcessApplicationComponentDiagramCommande.image = res/bmp/profile/processcomponent16.png
695
IntermediaryApplicationComponentDiagramCommande.label = Intermediary Component
696
IntermediaryApplicationComponentDiagramCommande.tooltip = Intermediary Component
697
IntermediaryApplicationComponentDiagramCommande.image = res/bmp/profile/intermediarycomponent16.png
698
PublicApplicationComponentDiagramCommande.label = Public Component
699
PublicApplicationComponentDiagramCommande.tooltip = Public Component
700
PublicApplicationComponentDiagramCommande.image = res/bmp/profile/publiccomponent16.png
701
UtilityApplicationComponentDiagramCommande.label = Utility Component
702
UtilityApplicationComponentDiagramCommande.tooltip = Utility Component
703
UtilityApplicationComponentDiagramCommande.image = res/bmp/profile/utilitycomponent16.png
704
EntityApplicationComponentDiagramCommande.label = Entity Component
705
EntityApplicationComponentDiagramCommande.tooltip = Entity Component
706
EntityApplicationComponentDiagramCommande.image = res/bmp/profile/entitycomponent16.png
707
DataBaseApplicationComponentDiagramCommande.label = Database
708
DataBaseApplicationComponentDiagramCommande.tooltip = Database
709
DataBaseApplicationComponentDiagramCommande.image = res/bmp/profile/databaseapplicationcomponent16.png
710
TogafApplicationCollaborationDiagramCommande.label = Application Collaboration
711
TogafApplicationCollaborationDiagramCommande.tooltip = Application Collaboration
712
TogafApplicationCollaborationDiagramCommande.image = res/bmp/profile/applicationcollaboration16.png
713
ProvidedServiceAccessDiagramCommande.label = Provided
714
ProvidedServiceAccessDiagramCommande.tooltip = Provided
715
ProvidedServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessprovide16.png
716
RequiredServiceAccessDiagramCommande.label = Required
717
RequiredServiceAccessDiagramCommande.tooltip = Required
718
RequiredServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessrequired16.png
719
TogafISServiceDiagramCommande.label = IS Service
720
TogafISServiceDiagramCommande.tooltip = IS Service
721
TogafISServiceDiagramCommande.image = res/bmp/profile/isservice16.png
722
TogafISServiceOperationDiagramCommande.label = IS Service Operation
723
TogafISServiceOperationDiagramCommande.tooltip = IS Service Operation
724
TogafISServiceOperationDiagramCommande.image = res/bmp/profile/isserviceoperation16.png
725
ApplicationComponentOperationDiagramCommande.label = Application Operation
726
ApplicationComponentOperationDiagramCommande.tooltip = Application Operation
727
ApplicationComponentOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
728
TogafApplicationComponentInstanceDiagramCommande.label = Application Instance
729
TogafApplicationComponentInstanceDiagramCommande.tooltip = Application Instance
730
TogafApplicationComponentInstanceDiagramCommande.image = res/bmp/profile/applicationcomponentinstance16.png
731
MessageDiagramCommande.label = Message
732
MessageDiagramCommande.tooltip = Message
733
MessageDiagramCommande.image = res/bmp/profile/servicedata16.png
734
ServiceDataFragmentDiagramCommande.label = Message Fragment
735
ServiceDataFragmentDiagramCommande.tooltip = Message Fragment
736
ServiceDataFragmentDiagramCommande.image = res/bmp/profile/servicedatafragment16.png
737
ApplicationArchitectureAttributeDiagramCommande.label = Application Attribute
738
ApplicationArchitectureAttributeDiagramCommande.tooltip = Application Attribute
739
ApplicationArchitectureAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png
740
InformationDomainDiagramCommande.label = Information Domain
741
InformationDomainDiagramCommande.tooltip = Information Domain
742
InformationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png
743
BusinessEntityDiagramCommande.label = Business Entity
744
BusinessEntityDiagramCommande.tooltip = Business Entity
745
BusinessEntityDiagramCommande.image = res/bmp/profile/businessentitys16.png
746
BusinessOperationDiagramCommande.label = Operation
747
BusinessOperationDiagramCommande.tooltip = Operation
748
BusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
749
BusinessAttributeDiagramCommande.label = Attribute
750
BusinessAttributeDiagramCommande.tooltip = Attribute
751
BusinessAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png
752
TogafEnumerationDiagramCommande.label = Enumeration
753
TogafEnumerationDiagramCommande.tooltip = Enumeration
754
TogafEnumerationDiagramCommande.image = res/bmp/profile/businessenumeration16.png
755
UMLEnumerationLitteralDiagramCommande.label = Enumeration Literal
756
UMLEnumerationLitteralDiagramCommande.tooltip = Enumeration Literal
757
UMLEnumerationLitteralDiagramCommande.image = res/bmp/modelio/umlenumerationlitteral.png
758
BusinessDataTypeDiagramCommande.label = Business Data Type
759
BusinessDataTypeDiagramCommande.tooltip = Business Data Type
760
BusinessDataTypeDiagramCommande.image = res/bmp/profile/businessdatatype16.png
761
UMLPortDiagramCommande.label = Port
762
UMLPortDiagramCommande.tooltip = Port
763
UMLPortDiagramCommande.image = res/bmp/modelio/umlport.png
764
TogafBusDiagramCommande.label = Bus
765
TogafBusDiagramCommande.tooltip = Bus
766
TogafBusDiagramCommande.image = res/bmp/profile/togafbus16.png
767
ConnexionDiagramCommande.label = Connection
768
ConnexionDiagramCommande.tooltip = Hardware Tecnology Component/Instance -> Hardware Tecnology Component/Instance
769
ConnexionDiagramCommande.image = res/bmp/profile/connexion16.png
770
NetworkLinkDiagramCommande.label = Network Link
771
NetworkLinkDiagramCommande.tooltip = Network Link : Technology Architecture Element/Technology Architecture Element
772
NetworkLinkDiagramCommande.image = res/bmp/profile/togafnetworklink16.png
773
TogafFunctionSequenceDiagramCommande.label = Sequence
774
TogafFunctionSequenceDiagramCommande.tooltip = Function -> Function
775
TogafFunctionSequenceDiagramCommande.image = res/bmp/profile/togaffunctionsequence16.png
776
IOFlowDiagramCommande.label = Flow
777
IOFlowDiagramCommande.tooltip = Any active element<-->Product/Entity/Event
778
IOFlowDiagramCommande.image = res/bmp/profile/ioflow16.png
779
AssumesDiagramCommande.label = Assumes
780
AssumesDiagramCommande.tooltip = Actor -> Role
781
AssumesDiagramCommande.image = res/bmp/profile/assumes16.png
782
TogafConsumesDiagramCommande.label = Consumes
783
TogafConsumesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Operation/Service/Component
784
TogafConsumesDiagramCommande.image = res/bmp/profile/togafconsumes16.png
785
InitiatorDiagramCommande.label = Initiator of
786
InitiatorDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process
787
InitiatorDiagramCommande.image = res/bmp/profile/initiator16.png
788
ResponsibleDiagramCommande.label = Responsible of
789
ResponsibleDiagramCommande.tooltip = Role/Actor -> Role/Actor/Organization Unit
790
ResponsibleDiagramCommande.image = res/bmp/profile/responsible16.png
791
ParticipatesDiagramCommande.label = Participates in
792
ParticipatesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service/Service Operation
793
ParticipatesDiagramCommande.image = res/bmp/profile/participates16.png
794
CommunicatesDiagramCommande.label = Communicates with
795
CommunicatesDiagramCommande.tooltip = Role/Actor -> Role/Actor
796
CommunicatesDiagramCommande.image = res/bmp/profile/communicates16.png
797
OwnerDiagramCommande.label = Owner of
798
OwnerDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service
799
OwnerDiagramCommande.image = res/bmp/profile/owner16.png
800
ContractOfDiagramCommand.label = Contract of
801
ContractOfDiagramCommand.tooltip = Service -> Service Contract
802
ContractOfDiagramCommand.image = res/bmp/profile/contractof16.png
803
TogafParticipantDecomposition.label = Composed of
804
TogafParticipantDecomposition.tooltip = Role/Actor -> Role/Actor
805
TogafParticipantDecomposition.image = res/bmp/profile/participantdecomposition16.png
806
ServiceProcessSupportDiagramCommande.label = Supports
807
ServiceProcessSupportDiagramCommande.tooltip = Service/Service Access/Process/Component -> Service/Process
808
ServiceProcessSupportDiagramCommande.image = res/bmp/profile/serviceprocesssupport16.png
809
PartDiagramCommande.label = Part
810
PartDiagramCommande.tooltip = Function <--> Function
811
PartDiagramCommande.image = res/bmp/profile/part16.png
812
TogafLocalizationDiagramCommande.label = Localization
813
TogafLocalizationDiagramCommande.tooltip = Role/Actor/Organization Unit -> Location
814
TogafLocalizationDiagramCommande.image = res/bmp/profile/togaflocalization16.png
815
TogafParticipantAllocationDiagramCommande.label = Allocated
816
TogafParticipantAllocationDiagramCommande.tooltip = Role/Actor -> Organization Unit
817
TogafParticipantAllocationDiagramCommande.image = res/bmp/profile/togafparticipantallocation16.png
818
ComponentRealizationDiagramCommande.label = Component Realization
819
ComponentRealizationDiagramCommande.tooltip = Component -> Service/Process/Use Case
820
ComponentRealizationDiagramCommande.image = res/bmp/profile/componentrealizationinitiator16.png
821
MigrationDiagramCommand.label = Migrate
822
MigrationDiagramCommand.tooltip = Migrate
823
MigrationDiagramCommand.image = res/bmp/profile/migration.png
824
UMLInformationFLowDiagramCommand.label = Information Flow
825
UMLInformationFLowDiagramCommand.tooltip = Information Flow
826
UMLInformationFLowDiagramCommand.image = res/bmp/modelio/umlinformationflow.png
827

    
828

    
829

    
830
TogafClassDiagramWizardContributor.label = Class diagram
831
TogafClassDiagramWizardContributor.icon =  res/bmp/profile/classdiagram16.png
832
TogafClassDiagramWizardContributor.info =  Class diagram
833
TogafClassDiagramWizardContributor.detail =  The key purpose of the Class diagram is to depict the relationships among the critical data entities (or classes) within the enterprise.
834
TogafClassDiagramWizardContributor.preview =  res/bmp/profile/classdiagrampreview.png
835
TogafClassHierachyDiagramWizardContributor.label = Class Hierarchy diagram
836
TogafClassHierachyDiagramWizardContributor.icon =  res/bmp/profile/classhierachydiagram16.png
837
TogafClassHierachyDiagramWizardContributor.info =  Class Hierarchy diagram
838
TogafClassHierachyDiagramWizardContributor.detail =  The purpose of the Class Hierarchy diagram is to show the technical stakeholders a perspective of the class hierarchy.
839
TogafClassHierachyDiagramWizardContributor.preview =  res/bmp/profile/classhierachydiagrampreview.png
840
TogafDataLifeCycleDiagramWizardContributor.label = Data Lifecycle diagram
841
TogafDataLifeCycleDiagramWizardContributor.icon =  res/bmp/profile/togafdatalifecyclediagram16.png
842
TogafDataLifeCycleDiagramWizardContributor.info =  Data Lifecycle diagram
843
TogafDataLifeCycleDiagramWizardContributor.detail =  The Entity Lifecycle diagram is an essential part of managing business entities throughout its lifecycle from conception until disposal within the constraints of the business process.
844
TogafDataLifeCycleDiagramWizardContributor.preview =  res/bmp/profile/togafdatalifecyclediagrampreview.png
845
TogafApplicationAndUserLocationDiagramWizardContributor.label = Application and User Location diagram
846
TogafApplicationAndUserLocationDiagramWizardContributor.icon =  res/bmp/profile/togafapplicationanduserlocationdiagram16.png
847
TogafApplicationAndUserLocationDiagramWizardContributor.info =  Application and User Location diagram
848
TogafApplicationAndUserLocationDiagramWizardContributor.detail =  The application and user location diagram shows the geographical distribution of applications.
849
TogafApplicationAndUserLocationDiagramWizardContributor.preview =  res/bmp/profile/togafapplicationanduserlocationdiagrampreview.png
850
TogafDataMigrationDiagramWizardContributor.label = Data Migration diagram
851
TogafDataMigrationDiagramWizardContributor.icon =  res/bmp/profile/datamigrationdiagram16.png
852
TogafDataMigrationDiagramWizardContributor.info =  Data Migration diagram
853
TogafDataMigrationDiagramWizardContributor.detail =  The purpose of the Data Migration diagram is to show the flow of data from the source to the target applications.
854
TogafDataMigrationDiagramWizardContributor.preview =  res/bmp/profile/datamigrationdiagrampreview.png
855
TogafBusinessFootPrintDiagramWizardContributor.label = Business Footprint diagram
856
TogafBusinessFootPrintDiagramWizardContributor.icon =  res/bmp/profile/businessfootprintdiagram16.png
857
TogafBusinessFootPrintDiagramWizardContributor.info =  Business Footprint diagram
858
TogafBusinessFootPrintDiagramWizardContributor.detail =  A Business Footprint diagram describes the links between business goals, organizational units, business functions, and services, and maps these functions to the technical components delivering the required capability.
859
TogafBusinessFootPrintDiagramWizardContributor.preview =  res/bmp/profile/businessfootprintdiagrampreview.png
860
TogafApplicationCommunicationDiagramWizardContributor.label = Application Communication diagram
861
TogafApplicationCommunicationDiagramWizardContributor.icon =  res/bmp/profile/applicationcommunicationdiagram16.png
862
TogafApplicationCommunicationDiagramWizardContributor.info =  Application Communication diagram
863
TogafApplicationCommunicationDiagramWizardContributor.detail =  The purpose of the Application Communication diagram is to depict all models and mappings related to communication between applications in the metamodel entity.
864
TogafApplicationCommunicationDiagramWizardContributor.preview =  res/bmp/profile/applicationcommunicationdiagrampreview.png
865
TogafSystemUseCaseDiagramWizardContributor.label = System Use Case diagram
866
TogafSystemUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafsystemusecasediagram16.png
867
TogafSystemUseCaseDiagramWizardContributor.info =  System Use Case diagram
868
TogafSystemUseCaseDiagramWizardContributor.detail =  A Use-Case diagram displays the relationships between consumers and providers of Services.
869
TogafSystemUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafsystemusecasediagrampreview.png
870
TogafApplicationMigrationDiagramWizardContributor.label = Application Migration diagram
871
TogafApplicationMigrationDiagramWizardContributor.icon =  res/bmp/profile/togafapplicationmigrationdiagram16.png
872
TogafApplicationMigrationDiagramWizardContributor.info =  Application Migration diagram
873
TogafApplicationMigrationDiagramWizardContributor.detail =  The Application Migration diagram identifies application migration from baseline to target application components.
874
TogafApplicationMigrationDiagramWizardContributor.preview =  res/bmp/profile/togafapplicationmigrationdiagrampreview.png
875
TogafDataDisseminationDiagramWizardContributor.label = Data Dissemination diagram
876
TogafDataDisseminationDiagramWizardContributor.icon =  res/bmp/profile/togafdatadisseminationdiagram16.png
877
TogafDataDisseminationDiagramWizardContributor.info =  Data Dissemination diagram
878
TogafDataDisseminationDiagramWizardContributor.detail =  The purpose of the Data Dissemination diagram is to show the relationship between data entities, business services, and application components.
879
TogafDataDisseminationDiagramWizardContributor.preview =  res/bmp/profile/togafdatadisseminationdiagrampreview.png
880
TogafEnterpriseManageabilityDiagramWizardContributor.label = Enterprise Manageability diagram
881
TogafEnterpriseManageabilityDiagramWizardContributor.icon =  res/bmp/profile/togafenterprisemanageabilitydiagram16.png
882
TogafEnterpriseManageabilityDiagramWizardContributor.info =  Enterprise Manageability diagram
883
TogafEnterpriseManageabilityDiagramWizardContributor.detail =  The Enterprise Manageability diagram shows how one or more applications interact with application and technology components that support operational management of a solution.
884
TogafEnterpriseManageabilityDiagramWizardContributor.preview =  res/bmp/profile/togafenterprisemanageabilitydiagrampreview.png
885
TogafProcessSystemRealizationDiagramWizardContributor.label = Process System Realization diagram
886
TogafProcessSystemRealizationDiagramWizardContributor.icon =  res/bmp/profile/togafprocesssystemrealizationdiagram16.png
887
TogafProcessSystemRealizationDiagramWizardContributor.info =  Process System Realization diagram
888
TogafProcessSystemRealizationDiagramWizardContributor.detail = The purpose of the Process/System Realization diagram is to clearly depict the sequence of events when multiple applications are involved in executing a business process.
889
TogafProcessSystemRealizationDiagramWizardContributor.preview =  res/bmp/profile/togafprocesssystemrealizationdiagrampreview.png
890
TogafProjectContextDiagramWizardContributor.label = Project Context diagram
891
TogafProjectContextDiagramWizardContributor.icon =  res/bmp/profile/togafprojectcontextdiagram16.png
892
TogafProjectContextDiagramWizardContributor.info =  Project Context diagram
893
TogafProjectContextDiagramWizardContributor.detail =  A Project Context diagram shows the scope of a work package to be implemented as a part of a broader transformation roadmap.
894
TogafProjectContextDiagramWizardContributor.preview =  res/bmp/profile/togafprojectcontextdiagrampreview.png
895
TogafSolutionConceptDiagramWizardContributor.label = Solution Concept diagram
896
TogafSolutionConceptDiagramWizardContributor.icon =  res/bmp/profile/togafsolutionconceptdiagram16.png
897
TogafSolutionConceptDiagramWizardContributor.info =  Solution Concept diagram
898
TogafSolutionConceptDiagramWizardContributor.detail =  A Solution Concept diagram provides a high-level orientation of the solution that is envisaged in order to meet the objectives of the architecture engagement.
899
TogafSolutionConceptDiagramWizardContributor.preview =  res/bmp/profile/togafsolutionconceptdiagrampreview.png
900
TogafBenefitsDiagramWizardContributor.label = Benefits diagram
901
TogafBenefitsDiagramWizardContributor.icon =  res/bmp/profile/togafbenefitsdiagram16.png
902
TogafBenefitsDiagramWizardContributor.info =  Benefits diagram
903
TogafBenefitsDiagramWizardContributor.detail =  The Benefits diagram shows opportunities identified in an architecture definition, classified according to their relative size, benefit, and complexity.
904
TogafBenefitsDiagramWizardContributor.preview =  res/bmp/profile/togafbenefitsdiagrampreview.png
905
TogafBusinessServiceInformationDiagramWizardContributor.label = Business Service Information diagram
906
TogafBusinessServiceInformationDiagramWizardContributor.icon =  res/bmp/profile/businessserviceinformationdiagram16.png
907
TogafBusinessServiceInformationDiagramWizardContributor.info =  Business Service Information diagram
908
TogafBusinessServiceInformationDiagramWizardContributor.detail = The Business Service/Information diagram shows the information needed to support one or more business services.
909
TogafBusinessServiceInformationDiagramWizardContributor.preview =  res/bmp/profile/businessserviceinformationdiagrampreview.png
910
TogafUseCaseDiagramWizardContributor.label = Use Case diagram
911
TogafUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafusecasediagram16.png
912
TogafUseCaseDiagramWizardContributor.info =  Use Case diagram
913
TogafUseCaseDiagramWizardContributor.detail =  A Use-Case diagram displays the relationships between consumers and providers of Services.
914
TogafUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafusecasediagrampreview.png
915
ServiceDataDiagramWizardContributor.label = Logical Data diagram
916
ServiceDataDiagramWizardContributor.icon =  res/bmp/profile/servicedatadiagram16.png
917
ServiceDataDiagramWizardContributor.info =  Logical Data diagram
918
ServiceDataDiagramWizardContributor.detail =  Messages need a dedicated model and definition.
919
ServiceDataDiagramWizardContributor.preview =  res/bmp/profile/servicedatadiagrampreview.png
920
SoftwareEngineeringDiagramWizardContributor.label = Software Engineering diagram
921
SoftwareEngineeringDiagramWizardContributor.icon =  res/bmp/modelio/softwareengineering16.png
922
SoftwareEngineeringDiagramWizardContributor.info =  Software Engineering diagram
923
SoftwareEngineeringDiagramWizardContributor.detail =  The purpose of Software Engineering diagrams is to define TOGAF Software Engineering
924
SoftwareDistributionDiagramWizardContributor.label = Software Distribution diagram
925
SoftwareDistributionDiagramWizardContributor.icon =  res/bmp/modelio/softwaredistribution16.png
926
SoftwareDistributionDiagramWizardContributor.info =  Software Distribution diagram
927
SoftwareDistributionDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
928
SoftwareDistributionDiagramWizardContributor.preview =  res/bmp/profile/softwaredistributionpreview.png
929
TogafProcessFlowDiagramWizardContributor.label = Process Flow diagram
930
TogafProcessFlowDiagramWizardContributor.icon =  res/bmp/profile/processflowdiagram16.png
931
TogafProcessFlowDiagramWizardContributor.info =  Process Flow diagram
932
TogafProcessFlowDiagramWizardContributor.detail =  Business Process modeling is done using business process diagrams.\nThe purpose of the business process diagram is to depict all models and mappings related to a process.
933
TogafProcessFlowDiagramWizardContributor.preview =  res/bmp/profile/processflowdiagrampreview.png
934
TogafFunctionalDecompositionDiagramWizardContributor.label = Functional Decomposition diagram
935
TogafFunctionalDecompositionDiagramWizardContributor.icon =  res/bmp/profile/functionaldecompositiondiagram16.png
936
TogafFunctionalDecompositionDiagramWizardContributor.info =  Togaf Functional Decomposition diagram
937
TogafFunctionalDecompositionDiagramWizardContributor.detail =  The purpose of the Functional Decomposition diagram is to show on a single page the capabilities of an organization that are relevant to the consideration of an architecture.
938
TogafFunctionalDecompositionDiagramWizardContributor.preview =  res/bmp/profile/functionaldecompositiondiagrampreview.png
939
TogafProductLifeCycleDiagramWizardContributor.label = Product Lifecycle diagram
940
TogafProductLifeCycleDiagramWizardContributor.icon =  res/bmp/profile/productlifecyclediagram16.png
941
TogafProductLifeCycleDiagramWizardContributor.info =  Product Lifecycle diagram
942
TogafProductLifeCycleDiagramWizardContributor.detail =  The purpose of the Product Lifecycle diagram is to assist in understanding the lifecycles of key entities within the enterprise.
943
TogafProductLifeCycleDiagramWizardContributor.preview =  res/bmp/profile/productlifecyclediagrampreview.png
944
TogafGoalObjectiveServiceDiagramWizardContributor.label = Driver/Goal/Objectives diagram
945
TogafGoalObjectiveServiceDiagramWizardContributor.icon =  res/bmp/profile/goalobjectiveservicediagram16.png
946
TogafGoalObjectiveServiceDiagramWizardContributor.info =  Driver/Goal/Objectives diagram
947
TogafGoalObjectiveServiceDiagramWizardContributor.detail = The purpose of a Goal/Objective/Service diagram is to define the ways in which a service contributes to the achievement of a business vision or strategy.
948
TogafGoalObjectiveServiceDiagramWizardContributor.preview =  res/bmp/profile/goalobjectiveservicediagrampreview.png
949
TogafBusinessUseCaseDiagramWizardContributor.label = Business Use Case diagram
950
TogafBusinessUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafusecasediagram16.png
951
TogafBusinessUseCaseDiagramWizardContributor.info =  Business Use Case diagram
952
TogafBusinessUseCaseDiagramWizardContributor.detail =  A Business Use-Case diagram displays the relationships between consumers and providers of business services.
953
TogafBusinessUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafusecasediagrampreview.png
954
TogafOrganizationRoleDiagramWizardContributor.label = Organization Role diagram
955
TogafOrganizationRoleDiagramWizardContributor.icon =  res/bmp/profile/organizationrolediagram16.png
956
TogafOrganizationRoleDiagramWizardContributor.info =  Organization Role diagram
957
TogafOrganizationRoleDiagramWizardContributor.detail =  Diagram dedicated to the definition of participants and their responsibilities. Roles and actors are modeled here.
958
TogafOrganizationRoleDiagramWizardContributor.preview =  res/bmp/profile/organizationrolediagrampreview.png
959
TogafOrganizationDecompositionDiagramWizardContributor.label = Organization Decomposition diagram
960
TogafOrganizationDecompositionDiagramWizardContributor.icon =  res/bmp/profile/organizationdecompositiondiagram16.png
961
TogafOrganizationDecompositionDiagramWizardContributor.info =  Organization Decomposition diagram
962
TogafOrganizationDecompositionDiagramWizardContributor.detail =  An Organization diagram describes the links between actors, and locations within an organization tree.
963
TogafOrganizationDecompositionDiagramWizardContributor.preview =  res/bmp/profile/organizationdecompositiondiagrampreview.png
964
TogafEventDiagramWizardContributor.label = Event diagram
965
TogafEventDiagramWizardContributor.icon =  res/bmp/profile/togafeventdiagram16.png
966
TogafEventDiagramWizardContributor.info =  Event diagram
967
TogafEventDiagramWizardContributor.detail =  The purpose of the process map diagram is to depict the relationship between events and process, and to show an overview of the business processes.
968
TogafEventDiagramWizardContributor.preview =  res/bmp/profile/togafeventdiagrampreview.png
969
TogafDataSecurityDiagramWizardContributor.label = Data Security diagram
970
TogafDataSecurityDiagramWizardContributor.icon =  res/bmp/profile/togafdatasecuritydiagram16.png
971
TogafDataSecurityDiagramWizardContributor.info =  Data Security diagram
972
TogafDataSecurityDiagramWizardContributor.detail =  Data is considered as an asset to the enterprise and data security simply means ensuring that enterprise data is not compromised and that access to it is suitably controlled.
973
TogafDataSecurityDiagramWizardContributor.preview =  res/bmp/profile/togafdatasecuritydiagrampreview.png
974
TogafValueChainDiagramWizardContributor.label = Value Chain diagram
975
TogafValueChainDiagramWizardContributor.icon =  res/bmp/profile/togafvaluechaindiagram16.png
976
TogafValueChainDiagramWizardContributor.info =  Value Chain diagram
977
TogafValueChainDiagramWizardContributor.detail =  A Value Chain diagram provides a high-level orientation view of an enterprise and how it interacts with the outside world.
978
TogafValueChainDiagramWizardContributor.preview =  res/bmp/profile/togafvaluechaindiagrampreview.png
979
TogafLocationDiagramWizardContributor.label = Location diagram
980
TogafLocationDiagramWizardContributor.icon =  res/bmp/profile/togaflocationdiagram16.png
981
TogafLocationDiagramWizardContributor.info =  Location diagram
982
TogafLocationDiagramWizardContributor.detail =  This kind of diagram helps in formalizing the locations of an enterprise, and the distribution of platforms and business services on it.
983
TogafLocationDiagramWizardContributor.preview =  res/bmp/profile/togaflocationdiagrampreview.png
984
TogafEnvironmentAndLocationsDiagramWizardContributor.label = Environment and Locations diagram
985
TogafEnvironmentAndLocationsDiagramWizardContributor.icon =  res/bmp/profile/togafenvironmentandlocationsdiagram16.png
986
TogafEnvironmentAndLocationsDiagramWizardContributor.info =  Environment and Locations diagram
987
TogafEnvironmentAndLocationsDiagramWizardContributor.detail =  Environments and Locations diagram depicts which locations host which applications, identifies what technologies and/or applications are used at which locations, and finally identifies the locations from which business users typically interact with the applications.
988
TogafEnvironmentAndLocationsDiagramWizardContributor.preview =  res/bmp/profile/togafenvironmentandlocationsdiagrampreview.png
989
TogafNewtorkComputingHardwareDiagramWizardContributor.label = Network Computing Hardware diagram
990
TogafNewtorkComputingHardwareDiagramWizardContributor.icon =  res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png
991
TogafNewtorkComputingHardwareDiagramWizardContributor.info =  Network Computing Hardware diagram
992
TogafNewtorkComputingHardwareDiagramWizardContributor.detail =  Representation of the deployment of service components to computing devices (i.e. servers, workstations, \u2026).
993
TogafNewtorkComputingHardwareDiagramWizardContributor.preview =  res/bmp/profile/togafnewtorkcomputinghardwarediagrampreview.png
994
TogafPlatformDecompositionDiagramWizardContributor.label = Platform decomposition diagram
995
TogafPlatformDecompositionDiagramWizardContributor.icon =  res/bmp/profile/togafplatformdecompositiondiagram16.png
996
TogafPlatformDecompositionDiagramWizardContributor.info =  Platform Decomposition diagram
997
TogafPlatformDecompositionDiagramWizardContributor.detail =  The Platform Decomposition diagram depicts the technology platform that supports the operations of the Information Systems Architecture.
998
TogafPlatformDecompositionDiagramWizardContributor.preview =  res/bmp/profile/togafplatformdecompositiondiagrampreview.png
999
TogafProcessingDiagramWizardContributor.label = Processing diagram
1000
TogafProcessingDiagramWizardContributor.icon =  res/bmp/profile/togafprocessingdiagram16.png
1001
TogafProcessingDiagramWizardContributor.info =  Processing diagram
1002
TogafProcessingDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
1003
TogafProcessingDiagramWizardContributor.preview = res/bmp/profile/togafprocessingdiagrampreview.png
1004
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram
1005
TogafCommunicationEngineeringDiagramsCommande.icon =  res/bmp/profile/togafcommunicationengineeringdiagrams16.png
1006
TogafCommunicationEngineeringDiagramsCommande.info =  Communication Engineering diagram
1007
TogafCommunicationEngineeringDiagramsCommande.detail =  The Communications Engineering diagram describes the means of communication, the method of sending and receiving information between these assets in the Technology Architecture; insofar as the selection of package solutions in the preceding architectures put specific requirements on the communications between the applications.
1008
TogafCommunicationEngineeringDiagramsCommande.preview =  res/bmp/profile/togafcommunicationengineeringdiagramspreview.png
1009
TogafSofwareDistributionDiagramWizardContributor.label = Software Distribution diagram
1010
TogafSofwareDistributionDiagramWizardContributor.icon =  res/bmp/profile/sofwaredistributiondiagram16.png
1011
TogafSofwareDistributionDiagramWizardContributor.info =  Software Distribution diagram
1012
TogafSofwareDistributionDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
1013
TogafSofwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png
1014
TogafMatrixDiagramWizardContributor.label = Traceability diagram
1015
TogafMatrixDiagramWizardContributor.icon =  res/bmp/profile/togafmatrixdiagram16.png
1016
TogafMatrixDiagramWizardContributor.info =  Traceability diagram
1017
TogafMatrixDiagramWizardContributor.detail =  The purpose of Matrix diagrams is to define dependencies that will produce the Excell Matrices. Matrix diagrams are also useful to define general purpose traceabilities between elements.
1018
TogafMatrixDiagramWizardContributor.preview =  res/bmp/profile/togafmatrixdiagrampreview.png
1019

    
1020

    
1021
TogafClassDiagramCommand.label = Class diagram
1022
TogafClassDiagramCommand.tooltip =  Class diagram
1023
TogafClassDiagramCommand.image =  res/bmp/profile/classdiagram16.png
1024
TogafClassHierachyDiagramCommand.label = Class Hierarchy diagram
1025
TogafClassHierachyDiagramCommand.tooltip =  Class Hierarchy diagram
1026
TogafClassHierachyDiagramCommand.image =  res/bmp/profile/classhierachydiagram16.png
1027
TogafDataLifeCycleDiagramCommand.label = Data Lifecycle diagram
1028
TogafDataLifeCycleDiagramCommand.tooltip =  Data Lifecycle diagram
1029
TogafDataLifeCycleDiagramCommand.image =  res/bmp/profile/togafdatalifecyclediagram16.png
1030
TogafApplicationAndUserLocationDiagramCommande.label = Application and User Location diagram
1031
TogafApplicationAndUserLocationDiagramCommande.tooltip =  Application and User Location diagram
1032
TogafApplicationAndUserLocationDiagramCommande.image =  res/bmp/profile/togafapplicationanduserlocationdiagram16.png
1033
TogafDataMigrationDiagramCommand.label = Data Migration diagram
1034
TogafDataMigrationDiagramCommand.tooltip =  Data Migration diagram
1035
TogafDataMigrationDiagramCommand.image =  res/bmp/profile/datamigrationdiagram16.png
1036
TogafBusinessFootPrintDiagramCommande.label = Business Footprint diagram
1037
TogafBusinessFootPrintDiagramCommande.tooltip =  Business Footprint diagram
1038
TogafBusinessFootPrintDiagramCommande.image =  res/bmp/profile/businessfootprintdiagram16.png
1039
TogafApplicationCommunicationDiagramCommande.label = Application Communication diagram
1040
TogafApplicationCommunicationDiagramCommande.tooltip =  Application Communication diagram
1041
TogafApplicationCommunicationDiagramCommande.image =  res/bmp/profile/applicationcommunicationdiagram16.png
1042
TogafSystemUseCaseDiagramCommande.label = System Use Case diagram
1043
TogafSystemUseCaseDiagramCommande.tooltip =  System Use Case diagram
1044
TogafSystemUseCaseDiagramCommande.image =  res/bmp/profile/togafsystemusecasediagram16.png
1045
TogafApplicationMigrationDiagramCommande.label = Application Migration diagram
1046
TogafApplicationMigrationDiagramCommande.tooltip =  Application Migration diagram
1047
TogafApplicationMigrationDiagramCommande.image =  res/bmp/profile/togafapplicationmigrationdiagram16.png
1048
TogafDataDisseminationDiagramCommande.label = Data Dissemination diagram
1049
TogafDataDisseminationDiagramCommande.tooltip =  Data Dissemination diagram
1050
TogafDataDisseminationDiagramCommande.image =  res/bmp/profile/togafdatadisseminationdiagram16.png
1051
TogafEnterpriseManageabilityDiagramCommande.label = Enterprise Manageability diagram
1052
TogafEnterpriseManageabilityDiagramCommande.tooltip =  Enterprise Manageability diagram
1053
TogafEnterpriseManageabilityDiagramCommande.image =  res/bmp/profile/togafenterprisemanageabilitydiagram16.png
1054
TogafProcessSystemRealizationDiagramCommande.label = Process System Realization diagram
1055
TogafProcessSystemRealizationDiagramCommande.tooltip =  Process System Realization diagram
1056
TogafProcessSystemRealizationDiagramCommande.image =  res/bmp/profile/togafprocesssystemrealizationdiagram16.png
1057
TogafProjectContextDiagramCommande.label = Project Context diagram
1058
TogafProjectContextDiagramCommande.tooltip =  Project Context diagram
1059
TogafProjectContextDiagramCommande.image =  res/bmp/profile/togafprojectcontextdiagram16.png
1060
TogafSolutionConceptDiagramCommande.label = Solution Concept diagram
1061
TogafSolutionConceptDiagramCommande.tooltip =  Solution Concept diagram
1062
TogafSolutionConceptDiagramCommande.image =  res/bmp/profile/togafsolutionconceptdiagram16.png
1063
TogafBenefitsDiagramCommande.label = Benefits diagram
1064
TogafBenefitsDiagramCommande.tooltip =  Benefits diagram
1065
TogafBenefitsDiagramCommande.image =  res/bmp/profile/togafbenefitsdiagram16.png
1066
TogafBusinessServiceInformationDiagramCommande.label = Business Service Information diagram
1067
TogafBusinessServiceInformationDiagramCommande.tooltip =  Business Service Information diagram
1068
TogafBusinessServiceInformationDiagramCommande.image =  res/bmp/profile/businessserviceinformationdiagram16.png
1069
TogafUseCaseDiagramCommande.label = Use Case diagram
1070
TogafUseCaseDiagramCommande.tooltip =  Use Case diagram
1071
TogafUseCaseDiagramCommande.image =  res/bmp/profile/togafusecasediagram16.png
1072
ServiceDataDiagramCommande.label = Logical Data diagram
1073
ServiceDataDiagramCommande.tooltip =  Logical Data diagram
1074
ServiceDataDiagramCommande.image =  res/bmp/profile/servicedatadiagram16.png
1075
SoftwareEngineeringDiagramCommande.label = Software Engineering diagram
1076
SoftwareEngineeringDiagramCommande.tooltip =  Software Engineering diagram
1077
SoftwareEngineeringDiagramCommande.image =  res/bmp/modelio/softwareengineering16.png
1078
SoftwareDistributionDiagramCommande.label = Software Distribution diagram
1079
SoftwareDistributionDiagramCommande.tooltip =  Software Distribution diagram
1080
SoftwareDistributionDiagramCommande.image =  res/bmp/modelio/softwaredistribution16.png
1081
TogafProcessFlowDiagramCommande.label = Process Flow diagram
1082
TogafProcessFlowDiagramCommande.tooltip =  Process Flow diagram
1083
TogafProcessFlowDiagramCommande.image =  res/bmp/profile/processflowdiagram16.png
1084
TogafFunctionalDecompositionDiagramCommande.label = Functional Decomposition diagram
1085
TogafFunctionalDecompositionDiagramCommande.tooltip =  Togaf Functional Decomposition diagram
1086
TogafFunctionalDecompositionDiagramCommande.image =  res/bmp/profile/functionaldecompositiondiagram16.png
1087
TogafProductLifeCycleDiagramCommande.label = Product Lifecycle diagram
1088
TogafProductLifeCycleDiagramCommande.tooltip =  Product Lifecycle diagram
1089
TogafProductLifeCycleDiagramCommande.image =  res/bmp/profile/productlifecyclediagram16.png
1090
TogafGoalObjectiveServiceDiagramCommande.label = Driver/Goal/Objectives diagram
1091
TogafGoalObjectiveServiceDiagramCommande.tooltip =  Driver/Goal/Objectives diagram
1092
TogafGoalObjectiveServiceDiagramCommande.image =  res/bmp/profile/goalobjectiveservicediagram16.png
1093
TogafBusinessUseCaseDiagramCommande.label = Business Use Case diagram
1094
TogafBusinessUseCaseDiagramCommande.tooltip =  Business Use Case diagram
1095
TogafBusinessUseCaseDiagramCommande.image =  res/bmp/profile/togafusecasediagram16.png
1096
TogafOrganizationRoleDiagramCommande.label = Organization Role diagram
1097
TogafOrganizationRoleDiagramCommande.tooltip =  Organization Role diagram
1098
TogafOrganizationRoleDiagramCommande.image =  res/bmp/profile/classhierachydiagram16.png
1099
TogafOrganizationDecompositionDiagramCommande.label = Organization Decomposition diagram
1100
TogafOrganizationDecompositionDiagramCommande.tooltip =  Organization Decomposition diagram
1101
TogafOrganizationDecompositionDiagramCommande.image =  res/bmp/profile/organizationdecompositiondiagram16.png
1102
TogafEventDiagramCommande.label = Event diagram
1103
TogafEventDiagramCommande.tooltip =  Event diagram
1104
TogafEventDiagramCommande.image =  res/bmp/profile/togafeventdiagram16.png
1105
TogafDataSecurityDiagramCommande.label = Data Security diagram
1106
TogafDataSecurityDiagramCommande.tooltip =  Data Security diagram
1107
TogafDataSecurityDiagramCommande.image =  res/bmp/profile/togafdatasecuritydiagram16.png
1108
TogafValueChainDiagramCommande.label = Value Chain diagram
1109
TogafValueChainDiagramCommande.tooltip =  Value Chain diagram
1110
TogafValueChainDiagramCommande.image =  res/bmp/profile/togafvaluechaindiagram16.png
1111
TogafLocationDiagramCommande.label = Location diagram
1112
TogafLocationDiagramCommande.tooltip =  Location diagram
1113
TogafLocationDiagramCommande.image =  res/bmp/profile/togaflocationdiagram16.png
1114
TogafEnvironmentAndLocationsDiagramCommande.label = Environment and Locations diagram
1115
TogafEnvironmentAndLocationsDiagramCommande.tooltip =  Environment and Locations diagram
1116
TogafEnvironmentAndLocationsDiagramCommande.image =  res/bmp/profile/togafenvironmentandlocationsdiagram16.png
1117
TogafNewtorkComputingHardwareDiagramCommande.label = Network Computing Hardware diagram
1118
TogafNewtorkComputingHardwareDiagramCommande.tooltip =  Network Computing Hardware diagram
1119
TogafNewtorkComputingHardwareDiagramCommande.image =  res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png
1120
TogafPlatformDecompositionDiagramCommande.label = Platform decomposition diagram
1121
TogafPlatformDecompositionDiagramCommande.tooltip =  Platform Decomposition diagram
1122
TogafPlatformDecompositionDiagramCommande.image =  res/bmp/profile/togafplatformdecompositiondiagram16.png
1123
TogafProcessingDiagramCommande.label = Processing diagram
1124
TogafProcessingDiagramCommande.tooltip =  Processing diagram
1125
TogafProcessingDiagramCommande.image =  res/bmp/profile/togafprocessingdiagram16.png
1126
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram
1127
TogafCommunicationEngineeringDiagramsCommande.tooltip =  Communication Engineering diagram
1128
TogafCommunicationEngineeringDiagramsCommande.image =  res/bmp/profile/togafcommunicationengineeringdiagrams16.png
1129
TogafSofwareDistributionDiagramCommande.label = Software Distribution diagram
1130
TogafSofwareDistributionDiagramCommande.tooltip =  Software Distribution diagram
1131
TogafSofwareDistributionDiagramCommande.image =  res/bmp/profile/sofwaredistributiondiagram16.png
1132
TogafSofwareDistributionDiagramCommande.preview = res/bmp/profile/softwaredistributionpreview.png
1133
TogafMatrixDiagramCommande.label = Traceability diagram
1134
TogafMatrixDiagramCommande.tooltip =  Traceability diagram
1135
TogafMatrixDiagramCommande.image =  res/bmp/profile/togafmatrixdiagram16.png
1136

    
1137
command.Migration_Modelio_3.7.label=Migration Modelio 3.7
1138
command.Migration_Modelio_3.7.tooltip=Migration Modelio 3.7
1139

    
1140
Diagrams.group = Togaf diagrams
1141
Diagrams.groupimage = res/bmp/profile/togafdiagram16.png
1142
TogafPropertyPage.label = Togaf
1143
TogafPropertyPage.image = res/bmp/togaf16.png