Statistics
| Revision:

root / branches / modelio3.7.x / src / main / conf / module.properties @ 242

History | View | Annotate | Download (73.1 KB)

1
ModuleLabel= Togaf Architect
2
ModuleDescription= Framework for Entreprise Architecture which provides a comprehensive approach to the design, planning, implementation, and governance of an enterprise information architecture. Version Open Source
3

    
4

    
5
CreateClassifier.label = Create a classifier from this instance
6
CreateClassifier.tooltip = Create a classifier from this instance
7
CreateClassifier.image =
8
CreateClassifier.group =
9
CreateClassifier.groupimage =
10
CreateClassifierByLifeline.label = Create a classifier from this instance
11
CreateClassifierByLifeline.tooltip = Create a classifier from this instance
12
CreateClassifierByLifeline.image =
13
CreateClassifierByLifeline.group =
14
CreateClassifierByLifeline.groupimage =
15
UpdateFromClassifier.label = Update instance or part from an existing classifier
16
UpdateFromClassifier.tooltip = Update instance or part from an existing classifier
17
UpdateFromClassifier.image =
18
UpdateFromClassifier.group =
19
UpdateFromClassifier.groupimage =
20
UpdateFromClassifierByLifeline.label = Update instance or part from an existing classifier
21
UpdateFromClassifierByLifeline.tooltip = Update instance or part from an existing classifier
22
UpdateFromClassifierByLifeline.image =
23
UpdateFromClassifierByLifeline.group =
24
UpdateFromClassifierByLifeline.groupimage =
25
CreateOperation.label = Create an operation from this message
26
CreateOperation.tooltip = Create an operation from this message
27
CreateOperation.image =
28
CreateOperation.group =
29
CreateOperation.groupimage =
30
CreateOperationFromTransition.label = Create an operation from this transition
31
CreateOperationFromTransition.tooltip = Create an operation from this transition
32
CreateOperationFromTransition.image =
33
CreateOperationFromTransition.group =
34
CreateOperationFromTransition.groupimage =
35
CreateAttribute.label = Create an attribute from this occurence
36
CreateAttribute.tooltip = Create an attribute from this occurence
37
CreateAttribute.image =
38
CreateAttribute.group =
39
CreateAttribute.groupimage =
40
UpdateClassesFromInterface.label = Update classes from this interface
41
UpdateClassesFromInterface.tooltip = Update classes from this interface
42
UpdateClassesFromInterface.image =
43
UpdateClassesFromInterface.group =
44
UpdateClassesFromInterface.groupimage =
45
ImplementInterfaces.label = Implement interfaces properties
46
ImplementInterfaces.tooltip = Implement interfaces properties
47
ImplementInterfaces.image =
48
ImplementInterfaces.group =
49
ImplementInterfaces.groupimage =
50
UnimplementInterfaces.label = Delete interface properties implementations
51
UnimplementInterfaces.tooltip = Delete interface properties implementations
52
UnimplementInterfaces.image =
53
UnimplementInterfaces.group =
54
UnimplementInterfaces.groupimage =
55
UpdateInternalStructure.label = Update internal structure
56
UpdateInternalStructure.tooltip = Update internal structure
57
UpdateInternalStructure.image =
58
UpdateInternalStructure.group =
59
UpdateInternalStructure.groupimage =
60
CreateStateMachineFromState.label = Create a state machine from this state
61
CreateStateMachineFromState.tooltip = Create a state machine from this state
62
CreateStateMachineFromState.image =
63
CreateStateMachineFromState.group =
64
CreateStateMachineFromState.groupimage =
65
UpdateStateFromStateMachine.label = Update state from an existing state machine
66
UpdateStateFromStateMachine.tooltip = Update state from an existing state machine
67
UpdateStateFromStateMachine.image =
68
UpdateStateFromStateMachine.group =
69
UpdateStateFromStateMachine.groupimage =
70
OpenDocument.label = Open
71
OpenDocument.tooltip = Open
72
OpenDocument.image =
73
OpenDocument.group =
74
OpenDocument.groupimage =
75
Directory.label = Directory
76
Directory.tooltip = Create a directory
77
Directory.image =
78
Directory.group =
79
Directory.groupimage =
80
Directory.label = Directory
81
Directory.tooltip = Create a directory
82
Directory.image =
83
Directory.group =
84
Directory.groupimage =
85
File.label = File
86
File.tooltip = Create a file
87
File.image =
88
File.group =
89
File.groupimage =
90
File.label = File
91
File.tooltip = Create a file
92
File.image =
93
File.group =
94
File.groupimage =
95
Mailadress.label = Mail address
96
Mailadress.tooltip = Create a mail address
97
Mailadress.image =
98
Mailadress.group =
99
Mailadress.groupimage =
100
Url.label = Url
101
Url.tooltip = Create an url
102
Url.image =
103
Url.group =
104
Url.groupimage =
105
BusinessLayer.label = Business Layer
106
BusinessLayer.tooltip = Business Layer
107
BusinessLayer.image = res/bmp/profile/businesslayer16.png
108
BusinessLayer.group =
109
BusinessLayer.groupimage =
110
ApplicationLayer.label = Application Layer
111
ApplicationLayer.tooltip = Application Layer
112
ApplicationLayer.image = res/bmp/profile/applicationlayer16.png
113
ApplicationLayer.group =
114
ApplicationLayer.groupimage =
115
BusinessEntities.label = Business Entities
116
BusinessEntities.tooltip = Business Entities
117
BusinessEntities.image = res/bmp/profile/businessentity16.png
118
BusinessEntities.group =
119
BusinessEntities.groupimage =
120
DataArchitecture.label = Data Architecture
121
DataArchitecture.tooltip = Data Architecture
122
DataArchitecture.image = res/bmp/profile/dataarchitecture16.png
123
DataArchitecture.group =
124
DataArchitecture.groupimage =
125
ApplicationArchitecture.label = Application Architecture
126
ApplicationArchitecture.tooltip = Application Architecture
127
ApplicationArchitecture.image = res/bmp/profile/applicationarchitecture16.png
128
ApplicationArchitecture.group =
129
ApplicationArchitecture.groupimage =
130
BusinessArchitecture.label = Business Architecture
131
BusinessArchitecture.tooltip = Business Architecture
132
BusinessArchitecture.image = res/bmp/profile/businessarchitecture16.png
133
BusinessArchitecture.group =
134
BusinessArchitecture.groupimage =
135
TechnologyArchitecture.label = Technology Architecture
136
TechnologyArchitecture.tooltip = Technology Architecture
137
TechnologyArchitecture.image = res/bmp/profile/technologylayer16.png
138
TechnologyArchitecture.group =
139
TechnologyArchitecture.groupimage =
140
Interaction.label = Interaction
141
Interaction.tooltip = Interaction
142
Interaction.image =
143
Interaction.group =
144
Interaction.groupimage =
145
CommunicationInteraction.label = Communication Interaction
146
CommunicationInteraction.tooltip = Communication Interaction
147
CommunicationInteraction.image =
148
CommunicationInteraction.group =
149
CommunicationInteraction.groupimage =
150
BPMNBehavior.label = BPMN Behavior
151
BPMNBehavior.tooltip = BPMN Behavior
152
BPMNBehavior.image =
153
BPMNBehavior.group =
154
BPMNBehavior.groupimage =
155
TechnologyDomain.label = Technology Domain
156
TechnologyDomain.tooltip = Technology Domain
157
TechnologyDomain.image = res/bmp/profile/technologydomain16.png
158
TechnologyDomain.group =
159
TechnologyDomain.groupimage =
160
Server.label = Server
161
Server.tooltip = Server
162
Server.image = res/bmp/profile/server16.png
163
Server.group = Device
164
Server.groupimage = res/bmp/profile/internet16.png
165
Workstation.label = Workstation
166
Workstation.tooltip = Workstation
167
Workstation.image = res/bmp/profile/workstation16.png
168
Workstation.group = Device
169
Workstation.groupimage =
170
Internet.label = Internet
171
Internet.tooltip = Internet
172
Internet.image = res/bmp/profile/internet16.png
173
Internet.group = Device
174
Internet.groupimage = res/bmp/profile/internet16.png
175
Router.label = Router
176
Router.tooltip = Router
177
Router.image = res/bmp/profile/router16.png
178
Router.group = Device
179
Router.groupimage = res/bmp/profile/internet16.png
180
Switch.label = Switch
181
Switch.tooltip = Switch
182
Switch.image = res/bmp/profile/switch16.png
183
Switch.group = Device
184
Switch.groupimage = res/bmp/profile/internet16.png
185
NetworkNode.label = Network Node
186
NetworkNode.tooltip = Network Node
187
NetworkNode.image = res/bmp/profile/networknode16.png
188
NetworkNode.group = Device
189
NetworkNode.groupimage = res/bmp/profile/internet16.png
190
TechnologyArtifact.label = Technology Artifact
191
TechnologyArtifact.tooltip = Technology Artifact
192
TechnologyArtifact.image = res/bmp/profile/artifact16.png
193
TechnologyArtifact.group =
194
TechnologyArtifact.groupimage =
195
OrganizationDomain.label = Organization Domain
196
OrganizationDomain.tooltip = Organization Domain
197
OrganizationDomain.image = res/bmp/profile/organizationsdomain16.png
198
OrganizationDomain.group = Organization
199
OrganizationDomain.groupimage = res/bmp/profile/organizationsdomain16.png
200
OrganizationUnit.label = Organization Unit
201
OrganizationUnit.tooltip = Organization Unit
202
OrganizationUnit.image = res/bmp/profile/organizationsunit16.png
203
OrganizationUnit.group = Organization
204
OrganizationUnit.groupimage =
205
ExternalActor.label = External Actor
206
ExternalActor.tooltip = External Actor
207
ExternalActor.image = res/bmp/profile/externalactor16.png
208
ExternalActor.group = Participant
209
ExternalActor.groupimage = res/bmp/profile/externalactor16.png
210
InternalActor.label = Internal Actor
211
InternalActor.tooltip = Internal Actor
212
InternalActor.image = res/bmp/profile/internalactor16.png
213
InternalActor.group = Participant
214
InternalActor.groupimage = res/bmp/profile/externalactor16.png
215
ExternalRole.label = External Role
216
ExternalRole.tooltip = External Role
217
ExternalRole.image = res/bmp/profile/externalrole16.png
218
ExternalRole.group = Participant
219
ExternalRole.groupimage = res/bmp/profile/externalactor16.png
220
InternalRole.label = Internal Role
221
InternalRole.tooltip = Internal Role
222
InternalRole.image = res/bmp/profile/internalrole16.png
223
InternalRole.group = Participant
224
InternalRole.groupimage = res/bmp/profile/externalactor16.png
225
Event.label = Event
226
Event.tooltip = Event
227
Event.image = res/bmp/profile/event16.png
228
Event.group =
229
Event.groupimage =
230
BusinessProcess.label = Business Process
231
BusinessProcess.tooltip = Business Process
232
BusinessProcess.image = res/bmp/profile/togafprocess16.png
233
BusinessProcess.group =
234
BusinessProcess.groupimage =
235
MacroProcess.label = Macro Process
236
MacroProcess.tooltip = Macro Process
237
MacroProcess.image = res/bmp/profile/macroprocessus16.png
238
MacroProcess.group =
239
MacroProcess.groupimage =
240
BusinessCollaboration.label = Business Collaboration
241
BusinessCollaboration.tooltip = Business Collaboration
242
BusinessCollaboration.image = res/bmp/profile/businesscollaboration16.png
243
BusinessCollaboration.group =
244
BusinessCollaboration.groupimage =
245
BusinessService.label = Business Service
246
BusinessService.tooltip = Business Service
247
BusinessService.image = res/bmp/profile/businessservice16.png
248
BusinessService.group =
249
BusinessService.groupimage =
250
ISService.label = IS Service
251
ISService.tooltip = IS Service
252
ISService.image = res/bmp/profile/isservice16.png
253
ISService.group =
254
ISService.groupimage =
255
Function.label = Function
256
Function.tooltip = Function
257
Function.image = res/bmp/profile/functionservice16.png
258
Function.group =
259
Function.groupimage =
260
Product.label = Product
261
Product.tooltip = Product
262
Product.image = res/bmp/profile/togafproduct16.png
263
Product.group =
264
Product.groupimage =
265
BusinessCapability.label = Business Capability
266
BusinessCapability.tooltip = Business Capability
267
BusinessCapability.image = res/bmp/profile/businesscapabilityservice16.png
268
BusinessCapability.group =
269
BusinessCapability.groupimage =
270
Operation.label = Operation
271
Operation.tooltip = Operation
272
Operation.image = res/bmp/profile/businessserviceoperation16.png
273
Operation.group =
274
Operation.groupimage =
275
ISServiceOperation.label = IS Service Operation
276
ISServiceOperation.tooltip = IS Service Operation
277
ISServiceOperation.image = res/bmp/profile/isserviceoperation16.png
278
ISServiceOperation.group =
279
ISServiceOperation.groupimage =
280
Location.label = Location
281
Location.tooltip = Location
282
Location.image = res/bmp/profile/location16.png
283
Location.group = Location
284
Location.groupimage = res/bmp/profile/location16.png
285
Headquarter.label = Headquarter
286
Headquarter.tooltip = Headquarter
287
Headquarter.image = res/bmp/profile/headquarterlocation16.png
288
Headquarter.group = Location
289
Headquarter.groupimage = res/bmp/profile/location16.png
290
ServiceContract.label = Service Contract
291
ServiceContract.tooltip = Service Contract
292
ServiceContract.image = res/bmp/profile/servicecontract16.png
293
ServiceContract.group =
294
ServiceContract.groupimage =
295
ApplicationDomain.label = Application Domain
296
ApplicationDomain.tooltip = Application Domain
297
ApplicationDomain.image = res/bmp/profile/applicationdomain16.png
298
ApplicationDomain.group =
299
ApplicationDomain.groupimage =
300
System.label = System
301
System.tooltip = System
302
System.image = res/bmp/profile/system16.png
303
System.group = System/Application
304
System.groupimage = res/bmp/profile/system16.png
305
SystemFederation.label = System Federation
306
SystemFederation.tooltip = System Federation
307
SystemFederation.image = res/bmp/profile/systemfederation16.png
308
SystemFederation.group = System/Application
309
SystemFederation.groupimage = res/bmp/profile/system16.png
310
EnterpriseSystem.label = Enterprise System
311
EnterpriseSystem.tooltip = Enterprise System
312
EnterpriseSystem.image = res/bmp/profile/enterprisesystem16.png
313
EnterpriseSystem.group = System/Application
314
EnterpriseSystem.groupimage = res/bmp/profile/system16.png
315
Application.label = Application
316
Application.tooltip = Application
317
Application.image = res/bmp/profile/application16.png
318
Application.group = System/Application
319
Application.groupimage = res/bmp/profile/system16.png
320
ServiceComponent.label = Service Component
321
ServiceComponent.tooltip = Service Component
322
ServiceComponent.image = res/bmp/profile/applicationcomponent16.png
323
ServiceComponent.group = Service Component
324
ServiceComponent.groupimage = res/bmp/profile/applicationcomponent16.png
325
InteractionComponent.label = Interaction Component
326
InteractionComponent.tooltip = Interaction Component
327
InteractionComponent.image = res/bmp/profile/interactioncomponent16.png
328
InteractionComponent.group = Service Component
329
InteractionComponent.groupimage = res/bmp/profile/applicationcomponent16.png
330
ProcessComponent.label = Process Component
331
ProcessComponent.tooltip = Process Component
332
ProcessComponent.image = res/bmp/profile/processcomponent16.png
333
ProcessComponent.group = Service Component
334
ProcessComponent.groupimage = res/bmp/profile/applicationcomponent16.png
335
IntermediaryComponent.label = Intermediary Component
336
IntermediaryComponent.tooltip = Intermediary Component
337
IntermediaryComponent.image = res/bmp/profile/intermediarycomponent16.png
338
IntermediaryComponent.group = Service Component
339
IntermediaryComponent.groupimage = res/bmp/profile/applicationcomponent16.png
340
PublicComponent.label = Public Component
341
PublicComponent.tooltip = Public Component
342
PublicComponent.image = res/bmp/profile/publiccomponent16.png
343
PublicComponent.group = Service Component
344
PublicComponent.groupimage = res/bmp/profile/applicationcomponent16.png
345
UtilityComponent.label = Utility Component
346
UtilityComponent.tooltip = Utility Component
347
UtilityComponent.image = res/bmp/profile/utilitycomponent16.png
348
UtilityComponent.group = Service Component
349
UtilityComponent.groupimage = res/bmp/profile/applicationcomponent16.png
350
EntityComponent.label = Entity Component
351
EntityComponent.tooltip = Entity Component
352
EntityComponent.image = res/bmp/profile/entitycomponent16.png
353
EntityComponent.group = Service Component
354
EntityComponent.groupimage = res/bmp/profile/applicationcomponent16.png
355
Database.label = Database
356
Database.tooltip = Database
357
Database.image = res/bmp/profile/databaseapplicationcomponent16.png
358
Database.group = Service Component
359
Database.groupimage = res/bmp/profile/applicationcomponent16.png
360
ApplicationCollaboration.label = Application Collaboration
361
ApplicationCollaboration.tooltip = Application Collaboration
362
ApplicationCollaboration.image = res/bmp/profile/applicationcollaboration16.png
363
ApplicationCollaboration.group =
364
ApplicationCollaboration.groupimage =
365
ApplicationInstance.label = Application Instance
366
ApplicationInstance.tooltip = Application Instance
367
ApplicationInstance.image = res/bmp/profile/applicationcomponentinstance16.png
368
ApplicationInstance.group =
369
ApplicationInstance.groupimage =
370
Message.label = Message
371
Message.tooltip = Message
372
Message.image = res/bmp/profile/servicedata16.png
373
Message.group =
374
Message.groupimage =
375
MessageFragment.label = Message Fragment
376
MessageFragment.tooltip = Message Fragment
377
MessageFragment.image = res/bmp/profile/servicedatafragment16.png
378
MessageFragment.group =
379
MessageFragment.groupimage =
380
ApplicationAttribute.label = Application Attribute
381
ApplicationAttribute.tooltip = Application Attribute
382
ApplicationAttribute.image = res/bmp/profile/businessattribute16.png
383
ApplicationAttribute.group =
384
ApplicationAttribute.groupimage =
385
ApplicationOperation.label = Application Operation
386
ApplicationOperation.tooltip = Application Operation
387
ApplicationOperation.image = res/bmp/profile/businessoperation16.png
388
ApplicationOperation.group =
389
ApplicationOperation.groupimage =
390
Provided.label = Provided
391
Provided.tooltip = Provided
392
Provided.image = res/bmp/profile/serviceaccessprovide16.png
393
Provided.group =
394
Provided.groupimage =
395
Required.label = Required
396
Required.tooltip = Required
397
Required.image = res/bmp/profile/serviceaccessrequired16.png
398
Required.group =
399
Required.groupimage =
400
InformationDomain.label = Information Domain
401
InformationDomain.tooltip = Information Domain
402
InformationDomain.image = res/bmp/profile/businessdomain16.png
403
InformationDomain.group =
404
InformationDomain.groupimage =
405
BusinessEntity.label = Business Entity
406
BusinessEntity.tooltip = Business Entity
407
BusinessEntity.image = res/bmp/profile/businessentitys16.png
408
BusinessEntity.group =
409
BusinessEntity.groupimage =
410
Attribute.label = Attribute
411
Attribute.tooltip = Attribute
412
Attribute.image = res/bmp/profile/businessattribute16.png
413
Attribute.group =
414
Attribute.groupimage =
415
Operation.label = Operation
416
Operation.tooltip = Operation
417
Operation.image = res/bmp/profile/businessoperation16.png
418
Operation.group =
419
Operation.groupimage =
420
Enumeration.label = Enumeration
421
Enumeration.tooltip = Enumeration
422
Enumeration.image = res/bmp/profile/businessenumeration16.png
423
Enumeration.group =
424
Enumeration.groupimage =
425
EnumerationLiteral.label = Enumeration Literal
426
EnumerationLiteral.tooltip = Enumeration Literal
427
EnumerationLiteral.image = res/bmp/modelio/umlenumerationlitteral.png
428
EnumerationLiteral.group =
429
EnumerationLiteral.groupimage =
430
BusinessDataType.label = Business Data Type
431
BusinessDataType.tooltip = Business Data Type
432
BusinessDataType.image = res/bmp/profile/businessdatatype16.png
433
BusinessDataType.group =
434
BusinessDataType.groupimage =
435
Lifecycle.label = Lifecycle
436
Lifecycle.tooltip = Lifecycle
437
Lifecycle.image = res/bmp/profile/entitylifecycle16.png
438
Lifecycle.group =
439
Lifecycle.groupimage =
440
Precondition.label = Precondition
441
Precondition.tooltip = Precondition
442
Precondition.image = res/bmp/profile/precondition16.png
443
Precondition.group =
444
Precondition.groupimage =
445
Postcondition.label = Postcondition
446
Postcondition.tooltip = Postcondition
447
Postcondition.image = res/bmp/profile/postcondition16.png
448
Postcondition.group =
449
Postcondition.groupimage =
450
Invariant.label = Invariant
451
Invariant.tooltip = Invariant
452
Invariant.image = res/bmp/profile/invariant16.png
453
Invariant.group =
454
Invariant.groupimage =
455
BusinessToExchangeDataTransformation.label = Message generation from Business Entities
456
BusinessToExchangeDataTransformation.tooltip = Message generation from Business Entities
457
BusinessToExchangeDataTransformation.image = res/bmp/exchangedatacommande16.png
458
BusinessToExchangeDataTransformation.group = Model transformation
459
BusinessToExchangeDataTransformation.groupimage = res/bmp/exchangedatacommande16.png
460
BusinessToPersistantTransformation.label = Data Model generation from Business Entities
461
BusinessToPersistantTransformation.tooltip = Data Model generation from Business Entities
462
BusinessToPersistantTransformation.image = res/bmp/businessentityscommande16.png
463
BusinessToPersistantTransformation.group = Model transformation
464
BusinessToPersistantTransformation.groupimage = res/bmp/exchangedatacommande16.png
465
ArchitectureToJavaTransformation.label = Transformation of Architecture model to Java implementation
466
ArchitectureToJavaTransformation.tooltip = Model transformation
467
ArchitectureToJavaTransformation.image = res/bmp/javacommande16.png
468
ArchitectureToJavaTransformation.group = Model transformation
469
ArchitectureToJavaTransformation.groupimage = res/bmp/exchangedatacommande16.png
470
ProductBusinessInteractionMatrix.label = Business - Interaction Matrix
471
ProductBusinessInteractionMatrix.tooltip = Business - Interaction Matrix
472
ProductBusinessInteractionMatrix.image = res/bmp/matrix16.png
473
ProductBusinessInteractionMatrix.group = Document production|Matrices
474
ProductBusinessInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
475
ProductActorRoleMatrix.label = Actor - Role Matrix
476
ProductActorRoleMatrix.tooltip = Actor - Role Matrix
477
ProductActorRoleMatrix.image = res/bmp/matrix16.png
478
ProductActorRoleMatrix.group = Document production|Matrices
479
ProductActorRoleMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
480
ProductDataEntityBusinessFunctionMatrix.label = Data Entity - Business Function Matrix
481
ProductDataEntityBusinessFunctionMatrix.tooltip = Data Entity - Business Function Matrix
482
ProductDataEntityBusinessFunctionMatrix.image = res/bmp/matrix16.png
483
ProductDataEntityBusinessFunctionMatrix.group = Document production|Matrices
484
ProductDataEntityBusinessFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
485
ProductSystemDataMatrix.label = Product - System - Data Matrix
486
ProductSystemDataMatrix.tooltip = Product - System - Data Matrix
487
ProductSystemDataMatrix.image = res/bmp/matrix16.png
488
ProductSystemDataMatrix.group = Document production|Matrices
489
ProductSystemDataMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
490
ProductSystemOrganizationMatrix.label = System - Organization Matrix
491
ProductSystemOrganizationMatrix.tooltip = Label=System - Organization Matrix
492
ProductSystemOrganizationMatrix.image = res/bmp/matrix16.png
493
ProductSystemOrganizationMatrix.group = Document production|Matrices
494
ProductSystemOrganizationMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
495
ProductRoleSystemMatrix.label = Role - System Matrix
496
ProductRoleSystemMatrix.tooltip = Role - System Matrix
497
ProductRoleSystemMatrix.image = res/bmp/matrix16.png
498
ProductRoleSystemMatrix.group = Document production|Matrices
499
ProductRoleSystemMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
500
ProductSystemFunctionMatrix.label = System - Function Matrix
501
ProductSystemFunctionMatrix.tooltip = System - Function Matrix
502
ProductSystemFunctionMatrix.image = res/bmp/matrix16.png
503
ProductSystemFunctionMatrix.group = Document production|Matrices
504
ProductSystemFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
505
ProductApplicationInteractionMatrix.label = Application - Interaction Matrix
506
ProductApplicationInteractionMatrix.tooltip = Application - Interaction Matrix
507
ProductApplicationInteractionMatrix.image = res/bmp/matrix16.png
508
ProductApplicationInteractionMatrix.group = Document production|Matrices
509
ProductApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
510
ProductOrganizationCatalog.label = Organization Catalog
511
ProductOrganizationCatalog.tooltip = Organization Catalog
512
ProductOrganizationCatalog.image = res/bmp/catalog16.png
513
ProductOrganizationCatalog.group = Document production|Catalogs
514
ProductOrganizationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
515
ProductRoleCatalog.label = Role - Actor Catalog
516
ProductRoleCatalog.tooltip = Role - Actor Catalog
517
ProductRoleCatalog.image = res/bmp/catalog16.png
518
ProductRoleCatalog.group = Document production|Catalogs
519
ProductRoleCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
520
ProductGoalCatalog.label = Driver - Goal - Objective Catalog
521
ProductGoalCatalog.tooltip = Driver - Goal - Objective Catalog
522
ProductGoalCatalog.image = res/bmp/catalog16.png
523
ProductGoalCatalog.group = Document production|Catalogs
524
ProductGoalCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
525
ProductBusinessCatalog.label = BusinessService - Function Catalog
526
ProductBusinessCatalog.tooltip = Business Service - Function Catalog
527
ProductBusinessCatalog.image = res/bmp/catalog16.png
528
ProductBusinessCatalog.group = Document production|Catalogs
529
ProductBusinessCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
530
ProductLocationCatalog.label = Location Catalog
531
ProductLocationCatalog.tooltip = Location Catalog
532
ProductLocationCatalog.image = res/bmp/catalog16.png
533
ProductLocationCatalog.group = Document production|Catalogs
534
ProductLocationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
535
ProductProcessEventControlProductCatalog.label = Process - Event - Control - Product Catalog
536
ProductProcessEventControlProductCatalog.tooltip = Process - Event - Control - Product Catalog
537
ProductProcessEventControlProductCatalog.image = res/bmp/catalog16.png
538
ProductProcessEventControlProductCatalog.group = Document production|Catalogs
539
ProductProcessEventControlProductCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
540
BusinessEntityCatalog.label = Business Entities Catalog
541
BusinessEntityCatalog.tooltip = Business Entities Catalog
542
BusinessEntityCatalog.image = res/bmp/extensioncatalog16.png
543
BusinessEntityCatalog.group = Document production|Catalogs (Modelio)
544
BusinessEntityCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
545
UseCasesCatalog.label = Use Cases Catalog
546
UseCasesCatalog.tooltip = Use Cases Catalog
547
UseCasesCatalog.image = res/bmp/extensioncatalog16.png
548
UseCasesCatalog.group = Document production|Catalogs (Modelio)
549
UseCasesCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
550
InformationServiceCatalog.label = Information Service Catalog
551
InformationServiceCatalog.tooltip = Information Service Catalog
552
InformationServiceCatalog.image = res/bmp/extensioncatalog16.png
553
InformationServiceCatalog.group = Document production|Catalogs (Modelio)
554
InformationServiceCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
555
ComponentCatalog.label = Component Catalog
556
ComponentCatalog.tooltip = Component Catalog
557
ComponentCatalog.image = res/bmp/extensioncatalog16.png
558
ComponentCatalog.group = Document production|Catalogs (Modelio)
559
ComponentCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
560
ServiceDataCatalog.label = Service Data Catalog
561
ServiceDataCatalog.tooltip = Service Data Catalog
562
ServiceDataCatalog.image = res/bmp/extensioncatalog16.png
563
ServiceDataCatalog.group = Document production|Catalogs (Modelio)
564
ServiceDataCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
565
CreateBusinessInteractionMatrix.label = Business - Interaction Matrix
566
CreateBusinessInteractionMatrix.tooltip = Create Business - Interaction Matrix
567
CreateBusinessInteractionMatrix.image = res/bmp/staticmatrix16.png
568
CreateBusinessInteractionMatrix.group = Traceability Matrices
569
CreateBusinessInteractionMatrix.groupimage = res/bmp/staticmatrix16.png
570
CreateActorRoleMatrix.label = Actor - Role Matrix
571
CreateActorRoleMatrix.tooltip = Create Actor - Role Matrix
572
CreateActorRoleMatrix.image = res/bmp/staticmatrix16.png
573
CreateActorRoleMatrix.group = Traceability Matrices
574
CreateActorRoleMatrix.groupimage = res/bmp/staticmatrix16.png
575
CreateDataEntityBusinessFunctionMatrix.label = DataEntity - BusinessFunction Matrix
576
CreateDataEntityBusinessFunctionMatrix.tooltip = Create DataEntity - BusinessFunction Matrix
577
CreateDataEntityBusinessFunctionMatrix.image = res/bmp/staticmatrix16.png
578
CreateDataEntityBusinessFunctionMatrix.group = Traceability Matrices
579
CreateDataEntityBusinessFunctionMatrix.groupimage = res/bmp/staticmatrix16.png
580
CreateSystemDataMatrix.label = System - Data Matrix
581
CreateSystemDataMatrix.tooltip = Create System - Data Matrix
582
CreateSystemDataMatrix.image = res/bmp/staticmatrix16.png
583
CreateSystemDataMatrix.group = Traceability Matrices
584
CreateSystemDataMatrix.groupimage = res/bmp/staticmatrix16.png
585
CreateSystemOrganizationMatrix.label = System - Organization Matrix
586
CreateSystemOrganizationMatrix.tooltip = Create System - Organization Matrix
587
CreateSystemOrganizationMatrix.image = res/bmp/staticmatrix16.png
588
CreateSystemOrganizationMatrix.group = Traceability Matrices
589
CreateSystemOrganizationMatrix.groupimage = res/bmp/staticmatrix16.png
590
CreateRoleSystemMatrix.label = Role - System Matrix
591
CreateRoleSystemMatrix.tooltip = Create Role - System Matrix
592
CreateRoleSystemMatrix.image = res/bmp/staticmatrix16.png
593
CreateRoleSystemMatrix.group = Traceability Matrices
594
CreateRoleSystemMatrix.groupimage = res/bmp/staticmatrix16.png
595
CreateSystemFunctionMatrix.label = System - Function Matrix
596
CreateSystemFunctionMatrix.tooltip = Create System - Function Matrix
597
CreateSystemFunctionMatrix.image = res/bmp/staticmatrix16.png
598
CreateSystemFunctionMatrix.group = Traceability Matrices
599
CreateSystemFunctionMatrix.groupimage = res/bmp/staticmatrix16.png
600
CreateApplicationInteractionMatrix.label = Application - Interaction Matrix
601
CreateApplicationInteractionMatrix.tooltip = Create Application - Interaction Matrix
602
CreateApplicationInteractionMatrix.image = res/bmp/staticmatrix16.png
603
CreateApplicationInteractionMatrix.group = Traceability Matrices
604
CreateApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png
605

    
606

    
607
TechnologyArchitectureDomainDiagramCommande.label = Technology Domain
608
TechnologyArchitectureDomainDiagramCommande.tooltip = Technology Domain
609
TechnologyArchitectureDomainDiagramCommande.image = res/bmp/profile/technologydomain16.png
610
DeploymentServerDiagramCommande.label = Server
611
DeploymentServerDiagramCommande.tooltip = Server
612
DeploymentServerDiagramCommande.image = res/bmp/profile/server16.png
613
DeploymentWorkStationDiagramCommande.label = Workstation
614
DeploymentWorkStationDiagramCommande.tooltip = Workstation
615
DeploymentWorkStationDiagramCommande.image = res/bmp/profile/workstation16.png
616
DeploymentInternetDiagramCommande.label = Internet
617
DeploymentInternetDiagramCommande.tooltip = Internet
618
DeploymentInternetDiagramCommande.image = res/bmp/profile/internet16.png
619
DeploymentRouterDiagramCommande.label = Router
620
DeploymentRouterDiagramCommande.tooltip = Router
621
DeploymentRouterDiagramCommande.image = res/bmp/profile/router16.png
622
DeploymentSwitchDiagramCommande.label = Switch
623
DeploymentSwitchDiagramCommande.tooltip = Switch
624
DeploymentSwitchDiagramCommande.image = res/bmp/profile/switch16.png
625
DeploymentNetworkNodeDiagramCommande.label = Network Node
626
DeploymentNetworkNodeDiagramCommande.tooltip = Network Node
627
DeploymentNetworkNodeDiagramCommande.image = res/bmp/profile/networknode16.png
628
BusinessOrganizationDomainDiagramCommande.label = Organization Domain
629
BusinessOrganizationDomainDiagramCommande.tooltip = Organization Domain
630
BusinessOrganizationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png
631
TogafExternalActorDiagramCommande.label = External Actor
632
TogafExternalActorDiagramCommande.tooltip = External Actor
633
TogafExternalActorDiagramCommande.image = res/bmp/profile/externalactor16.png
634
TogafInternalActorDiagramCommande.label = Internal Actor
635
TogafInternalActorDiagramCommande.tooltip = Internal Actor
636
TogafInternalActorDiagramCommande.image = res/bmp/profile/internalactor16.png
637
TogafExternalRoleDiagramCommande.label = External Role
638
TogafExternalRoleDiagramCommande.tooltip = External Role
639
TogafExternalRoleDiagramCommande.image = res/bmp/profile/externalrole16.png
640
TogafInternalRoleDiagramCommande.label = Internal Role
641
TogafInternalRoleDiagramCommande.tooltip = Internal Role
642
TogafInternalRoleDiagramCommande.image = res/bmp/profile/internalrole16.png
643
EventDiagramCommande.label = Event
644
EventDiagramCommande.tooltip = Event
645
EventDiagramCommande.image = res/bmp/profile/event16.png
646
TogafOrganizationUnitDiagramCommande.label = Organization Unit
647
TogafOrganizationUnitDiagramCommande.tooltip = Organization Unit
648
TogafOrganizationUnitDiagramCommande.image = res/bmp/profile/organizationsunit16.png
649
TogafProcessDiagramCommande.label = Business Process
650
TogafProcessDiagramCommande.tooltip = Business Process
651
TogafProcessDiagramCommande.image = res/bmp/profile/togafprocess16.png
652
TogafMacroProcessDiagramCommande.label = Macro Process
653
TogafMacroProcessDiagramCommande.tooltip = Macro Process
654
TogafMacroProcessDiagramCommande.image = res/bmp/profile/macroprocessus16.png
655
TogafBusinessCollaborationDiagramCommande.label = Business Collaboration
656
TogafBusinessCollaborationDiagramCommande.tooltip = Business Collaboration
657
TogafBusinessCollaborationDiagramCommande.image = res/bmp/profile/businesscollaboration16.png
658
TogafFunctionDiagramCommande.label = Function
659
TogafFunctionDiagramCommande.tooltip = Function
660
TogafFunctionDiagramCommande.image = res/bmp/profile/functionservice16.png
661
TogafBusinessServiceDiagramCommande.label = Business Service
662
TogafBusinessServiceDiagramCommande.tooltip = Business Service
663
TogafBusinessServiceDiagramCommande.image = res/bmp/profile/businessservice16.png
664
TogafBusinessCapabilityDiagramCommande.label = Business Capability
665
TogafBusinessCapabilityDiagramCommande.tooltip = Business Capability
666
TogafBusinessCapabilityDiagramCommande.image = res/bmp/profile/businesscapabilityservice16.png
667
TogafBusinessOperationDiagramCommande.label = Operation
668
TogafBusinessOperationDiagramCommande.tooltip = Operation
669
TogafBusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
670
TogafProductDiagramCommande.label = Product
671
TogafProductDiagramCommande.tooltip = Product
672
TogafProductDiagramCommande.image = res/bmp/profile/togafproduct16.png
673
LocationDiagramCommande.label = Location
674
LocationDiagramCommande.tooltip = Location
675
LocationDiagramCommande.image = res/bmp/profile/location16.png
676
HeadquarterLocationDiagramCommande.label = Headquarter
677
HeadquarterLocationDiagramCommande.tooltip = Headquarter
678
HeadquarterLocationDiagramCommande.image = res/bmp/profile/headquarterlocation16.png
679
TogafServiceContractDiagramCommande.label = Service Contract
680
TogafServiceContractDiagramCommande.tooltip = Service Contract
681
TogafServiceContractDiagramCommande.image = res/bmp/profile/servicecontract16.png
682
SystemApplicationComponentDiagramCommande.label = System
683
SystemApplicationComponentDiagramCommande.tooltip = System
684
SystemApplicationComponentDiagramCommande.image = res/bmp/profile/system16.png
685
TogafSystemFederationDiagramCommande.label = System Federation
686
TogafSystemFederationDiagramCommande.tooltip = System Federation
687
TogafSystemFederationDiagramCommande.image = res/bmp/profile/systemfederation16.png
688
TogafEnterpriseSystemDiagramCommande.label = Enterprise System
689
TogafEnterpriseSystemDiagramCommande.tooltip = Enterprise System
690
TogafEnterpriseSystemDiagramCommande.image = res/bmp/profile/enterprisesystem16.png
691
TogafApplicationDiagramCommande.label = Application
692
TogafApplicationDiagramCommande.tooltip = Application
693
TogafApplicationDiagramCommande.image = res/bmp/profile/application16.png
694
ServiceApplicationComponentDiagramCommande.label = Service Component
695
ServiceApplicationComponentDiagramCommande.tooltip = Service Component
696
ServiceApplicationComponentDiagramCommande.image = res/bmp/profile/applicationcomponent16.png
697
InteractionApplicationComponentDiagramCommande.label = Interaction Component
698
InteractionApplicationComponentDiagramCommande.tooltip = Interaction Component
699
InteractionApplicationComponentDiagramCommande.image = res/bmp/profile/interactioncomponent16.png
700
ProcessApplicationComponentDiagramCommande.label = Process Component
701
ProcessApplicationComponentDiagramCommande.tooltip = Process Component
702
ProcessApplicationComponentDiagramCommande.image = res/bmp/profile/processcomponent16.png
703
IntermediaryApplicationComponentDiagramCommande.label = Intermediary Component
704
IntermediaryApplicationComponentDiagramCommande.tooltip = Intermediary Component
705
IntermediaryApplicationComponentDiagramCommande.image = res/bmp/profile/intermediarycomponent16.png
706
PublicApplicationComponentDiagramCommande.label = Public Component
707
PublicApplicationComponentDiagramCommande.tooltip = Public Component
708
PublicApplicationComponentDiagramCommande.image = res/bmp/profile/publiccomponent16.png
709
UtilityApplicationComponentDiagramCommande.label = Utility Component
710
UtilityApplicationComponentDiagramCommande.tooltip = Utility Component
711
UtilityApplicationComponentDiagramCommande.image = res/bmp/profile/utilitycomponent16.png
712
EntityApplicationComponentDiagramCommande.label = Entity Component
713
EntityApplicationComponentDiagramCommande.tooltip = Entity Component
714
EntityApplicationComponentDiagramCommande.image = res/bmp/profile/entitycomponent16.png
715
DataBaseApplicationComponentDiagramCommande.label = Database
716
DataBaseApplicationComponentDiagramCommande.tooltip = Database
717
DataBaseApplicationComponentDiagramCommande.image = res/bmp/profile/databaseapplicationcomponent16.png
718
TogafApplicationCollaborationDiagramCommande.label = Application Collaboration
719
TogafApplicationCollaborationDiagramCommande.tooltip = Application Collaboration
720
TogafApplicationCollaborationDiagramCommande.image = res/bmp/profile/applicationcollaboration16.png
721
ProvidedServiceAccessDiagramCommande.label = Provided
722
ProvidedServiceAccessDiagramCommande.tooltip = Provided
723
ProvidedServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessprovide16.png
724
RequiredServiceAccessDiagramCommande.label = Required
725
RequiredServiceAccessDiagramCommande.tooltip = Required
726
RequiredServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessrequired16.png
727
TogafISServiceDiagramCommande.label = IS Service
728
TogafISServiceDiagramCommande.tooltip = IS Service
729
TogafISServiceDiagramCommande.image = res/bmp/profile/isservice16.png
730
TogafISServiceOperationDiagramCommande.label = IS Service Operation
731
TogafISServiceOperationDiagramCommande.tooltip = IS Service Operation
732
TogafISServiceOperationDiagramCommande.image = res/bmp/profile/isserviceoperation16.png
733
ApplicationComponentOperationDiagramCommande.label = Application Operation
734
ApplicationComponentOperationDiagramCommande.tooltip = Application Operation
735
ApplicationComponentOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
736
TogafApplicationComponentInstanceDiagramCommande.label = Application Instance
737
TogafApplicationComponentInstanceDiagramCommande.tooltip = Application Instance
738
TogafApplicationComponentInstanceDiagramCommande.image = res/bmp/profile/applicationcomponentinstance16.png
739
MessageDiagramCommande.label = Message
740
MessageDiagramCommande.tooltip = Message
741
MessageDiagramCommande.image = res/bmp/profile/servicedata16.png
742
ServiceDataFragmentDiagramCommande.label = Message Fragment
743
ServiceDataFragmentDiagramCommande.tooltip = Message Fragment
744
ServiceDataFragmentDiagramCommande.image = res/bmp/profile/servicedatafragment16.png
745
ApplicationArchitectureAttributeDiagramCommande.label = Application Attribute
746
ApplicationArchitectureAttributeDiagramCommande.tooltip = Application Attribute
747
ApplicationArchitectureAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png
748
InformationDomainDiagramCommande.label = Information Domain
749
InformationDomainDiagramCommande.tooltip = Information Domain
750
InformationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png
751
BusinessEntityDiagramCommande.label = Business Entity
752
BusinessEntityDiagramCommande.tooltip = Business Entity
753
BusinessEntityDiagramCommande.image = res/bmp/profile/businessentitys16.png
754
BusinessOperationDiagramCommande.label = Operation
755
BusinessOperationDiagramCommande.tooltip = Operation
756
BusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
757
BusinessAttributeDiagramCommande.label = Attribute
758
BusinessAttributeDiagramCommande.tooltip = Attribute
759
BusinessAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png
760
TogafEnumerationDiagramCommande.label = Enumeration
761
TogafEnumerationDiagramCommande.tooltip = Enumeration
762
TogafEnumerationDiagramCommande.image = res/bmp/profile/businessenumeration16.png
763
UMLEnumerationLitteralDiagramCommande.label = Enumeration Literal
764
UMLEnumerationLitteralDiagramCommande.tooltip = Enumeration Literal
765
UMLEnumerationLitteralDiagramCommande.image = res/bmp/modelio/umlenumerationlitteral.png
766
BusinessDataTypeDiagramCommande.label = Business Data Type
767
BusinessDataTypeDiagramCommande.tooltip = Business Data Type
768
BusinessDataTypeDiagramCommande.image = res/bmp/profile/businessdatatype16.png
769
UMLPortDiagramCommande.label = Port
770
UMLPortDiagramCommande.tooltip = Port
771
UMLPortDiagramCommande.image = res/bmp/modelio/umlport.png
772
TogafBusDiagramCommande.label = Bus
773
TogafBusDiagramCommande.tooltip = Bus
774
TogafBusDiagramCommande.image = res/bmp/profile/togafbus16.png
775
ConnexionDiagramCommande.label = Connection
776
ConnexionDiagramCommande.tooltip = Hardware Tecnology Component/Instance -> Hardware Tecnology Component/Instance
777
ConnexionDiagramCommande.image = res/bmp/profile/connexion16.png
778
NetworkLinkDiagramCommande.label = Network Link
779
NetworkLinkDiagramCommande.tooltip = Network Link : Technology Architecture Element/Technology Architecture Element
780
NetworkLinkDiagramCommande.image = res/bmp/profile/togafnetworklink16.png
781
TogafFunctionSequenceDiagramCommande.label = Sequence
782
TogafFunctionSequenceDiagramCommande.tooltip = Function -> Function
783
TogafFunctionSequenceDiagramCommande.image = res/bmp/profile/togaffunctionsequence16.png
784
IOFlowDiagramCommande.label = Flow
785
IOFlowDiagramCommande.tooltip = Any active element<-->Product/Entity/Event
786
IOFlowDiagramCommande.image = res/bmp/profile/ioflow16.png
787
AssumesDiagramCommande.label = Assumes
788
AssumesDiagramCommande.tooltip = Actor -> Role
789
AssumesDiagramCommande.image = res/bmp/profile/assumes16.png
790
TogafConsumesDiagramCommande.label = Consumes
791
TogafConsumesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Operation/Service/Component
792
TogafConsumesDiagramCommande.image = res/bmp/profile/togafconsumes16.png
793
InitiatorDiagramCommande.label = Initiator of
794
InitiatorDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process
795
InitiatorDiagramCommande.image = res/bmp/profile/initiator16.png
796
ResponsibleDiagramCommande.label = Responsible of
797
ResponsibleDiagramCommande.tooltip = Role/Actor -> Role/Actor/Organization Unit
798
ResponsibleDiagramCommande.image = res/bmp/profile/responsible16.png
799
ParticipatesDiagramCommande.label = Participates in
800
ParticipatesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service/Service Operation
801
ParticipatesDiagramCommande.image = res/bmp/profile/participates16.png
802
CommunicatesDiagramCommande.label = Communicates with
803
CommunicatesDiagramCommande.tooltip = Role/Actor -> Role/Actor
804
CommunicatesDiagramCommande.image = res/bmp/profile/communicates16.png
805
OwnerDiagramCommande.label = Owner of
806
OwnerDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service
807
OwnerDiagramCommande.image = res/bmp/profile/owner16.png
808
ContractOfDiagramCommand.label = Contract of
809
ContractOfDiagramCommand.tooltip = Service -> Service Contract
810
ContractOfDiagramCommand.image = res/bmp/profile/contractof16.png
811
TogafParticipantDecomposition.label = Composed of
812
TogafParticipantDecomposition.tooltip = Role/Actor -> Role/Actor
813
TogafParticipantDecomposition.image = res/bmp/profile/participantdecomposition16.png
814
ServiceProcessSupportDiagramCommande.label = Supports
815
ServiceProcessSupportDiagramCommande.tooltip = Service/Service Access/Process/Component -> Service/Process
816
ServiceProcessSupportDiagramCommande.image = res/bmp/profile/serviceprocesssupport16.png
817
PartDiagramCommande.label = Part
818
PartDiagramCommande.tooltip = Function <--> Function
819
PartDiagramCommande.image = res/bmp/profile/part16.png
820
TogafLocalizationDiagramCommande.label = Localization
821
TogafLocalizationDiagramCommande.tooltip = Role/Actor/Organization Unit -> Location
822
TogafLocalizationDiagramCommande.image = res/bmp/profile/togaflocalization16.png
823
TogafParticipantAllocationDiagramCommande.label = Allocated
824
TogafParticipantAllocationDiagramCommande.tooltip = Role/Actor -> Organization Unit
825
TogafParticipantAllocationDiagramCommande.image = res/bmp/profile/togafparticipantallocation16.png
826
ComponentRealizationDiagramCommande.label = Component Realization
827
ComponentRealizationDiagramCommande.tooltip = Component -> Service/Process/Use Case
828
ComponentRealizationDiagramCommande.image = res/bmp/profile/componentrealizationinitiator16.png
829
MigrationDiagramCommand.label = Migrate
830
MigrationDiagramCommand.tooltip = Migrate
831
MigrationDiagramCommand.image = res/bmp/profile/migration.png
832
UMLInformationFLowDiagramCommand.label = Information Flow
833
UMLInformationFLowDiagramCommand.tooltip = Information Flow
834
UMLInformationFLowDiagramCommand.image = res/bmp/modelio/umlinformationflow.png
835

    
836

    
837

    
838
TogafClassDiagramWizardContributor.label = Class diagram
839
TogafClassDiagramWizardContributor.icon =  res/bmp/profile/classdiagram16.png
840
TogafClassDiagramWizardContributor.info =  Class diagram
841
TogafClassDiagramWizardContributor.detail =  The key purpose of the Class diagram is to depict the relationships among the critical data entities (or classes) within the enterprise.
842
TogafClassDiagramWizardContributor.preview =  res/bmp/profile/classdiagrampreview.png
843
TogafClassHierachyDiagramWizardContributor.label = Class Hierarchy diagram
844
TogafClassHierachyDiagramWizardContributor.icon =  res/bmp/profile/classhierachydiagram16.png
845
TogafClassHierachyDiagramWizardContributor.info =  Class Hierarchy diagram
846
TogafClassHierachyDiagramWizardContributor.detail =  The purpose of the Class Hierarchy diagram is to show the technical stakeholders a perspective of the class hierarchy.
847
TogafClassHierachyDiagramWizardContributor.preview =  res/bmp/profile/classhierachydiagrampreview.png
848
TogafDataLifeCycleDiagramWizardContributor.label = Data Lifecycle diagram
849
TogafDataLifeCycleDiagramWizardContributor.icon =  res/bmp/profile/togafdatalifecyclediagram16.png
850
TogafDataLifeCycleDiagramWizardContributor.info =  Data Lifecycle diagram
851
TogafDataLifeCycleDiagramWizardContributor.detail =  The Entity Lifecycle diagram is an essential part of managing business entities throughout its lifecycle from conception until disposal within the constraints of the business process.
852
TogafDataLifeCycleDiagramWizardContributor.preview =  res/bmp/profile/togafdatalifecyclediagrampreview.png
853
TogafApplicationAndUserLocationDiagramWizardContributor.label = Application and User Location diagram
854
TogafApplicationAndUserLocationDiagramWizardContributor.icon =  res/bmp/profile/togafapplicationanduserlocationdiagram16.png
855
TogafApplicationAndUserLocationDiagramWizardContributor.info =  Application and User Location diagram
856
TogafApplicationAndUserLocationDiagramWizardContributor.detail =  The application and user location diagram shows the geographical distribution of applications.
857
TogafApplicationAndUserLocationDiagramWizardContributor.preview =  res/bmp/profile/togafapplicationanduserlocationdiagrampreview.png
858
TogafDataMigrationDiagramWizardContributor.label = Data Migration diagram
859
TogafDataMigrationDiagramWizardContributor.icon =  res/bmp/profile/datamigrationdiagram16.png
860
TogafDataMigrationDiagramWizardContributor.info =  Data Migration diagram
861
TogafDataMigrationDiagramWizardContributor.detail =  The purpose of the Data Migration diagram is to show the flow of data from the source to the target applications.
862
TogafDataMigrationDiagramWizardContributor.preview =  res/bmp/profile/datamigrationdiagrampreview.png
863
TogafBusinessFootPrintDiagramWizardContributor.label = Business Footprint diagram
864
TogafBusinessFootPrintDiagramWizardContributor.icon =  res/bmp/profile/businessfootprintdiagram16.png
865
TogafBusinessFootPrintDiagramWizardContributor.info =  Business Footprint diagram
866
TogafBusinessFootPrintDiagramWizardContributor.detail =  A Business Footprint diagram describes the links between business goals, organizational units, business functions, and services, and maps these functions to the technical components delivering the required capability.
867
TogafBusinessFootPrintDiagramWizardContributor.preview =  res/bmp/profile/businessfootprintdiagrampreview.png
868
TogafApplicationCommunicationDiagramWizardContributor.label = Application Communication diagram
869
TogafApplicationCommunicationDiagramWizardContributor.icon =  res/bmp/profile/applicationcommunicationdiagram16.png
870
TogafApplicationCommunicationDiagramWizardContributor.info =  Application Communication diagram
871
TogafApplicationCommunicationDiagramWizardContributor.detail =  The purpose of the Application Communication diagram is to depict all models and mappings related to communication between applications in the metamodel entity.
872
TogafApplicationCommunicationDiagramWizardContributor.preview =  res/bmp/profile/applicationcommunicationdiagrampreview.png
873
TogafSystemUseCaseDiagramWizardContributor.label = System Use Case diagram
874
TogafSystemUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafsystemusecasediagram16.png
875
TogafSystemUseCaseDiagramWizardContributor.info =  System Use Case diagram
876
TogafSystemUseCaseDiagramWizardContributor.detail =  A Use-Case diagram displays the relationships between consumers and providers of Services.
877
TogafSystemUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafsystemusecasediagrampreview.png
878
TogafApplicationMigrationDiagramWizardContributor.label = Application Migration diagram
879
TogafApplicationMigrationDiagramWizardContributor.icon =  res/bmp/profile/togafapplicationmigrationdiagram16.png
880
TogafApplicationMigrationDiagramWizardContributor.info =  Application Migration diagram
881
TogafApplicationMigrationDiagramWizardContributor.detail =  The Application Migration diagram identifies application migration from baseline to target application components.
882
TogafApplicationMigrationDiagramWizardContributor.preview =  res/bmp/profile/togafapplicationmigrationdiagrampreview.png
883
TogafDataDisseminationDiagramWizardContributor.label = Data Dissemination diagram
884
TogafDataDisseminationDiagramWizardContributor.icon =  res/bmp/profile/togafdatadisseminationdiagram16.png
885
TogafDataDisseminationDiagramWizardContributor.info =  Data Dissemination diagram
886
TogafDataDisseminationDiagramWizardContributor.detail =  The purpose of the Data Dissemination diagram is to show the relationship between data entities, business services, and application components.
887
TogafDataDisseminationDiagramWizardContributor.preview =  res/bmp/profile/togafdatadisseminationdiagrampreview.png
888
TogafEnterpriseManageabilityDiagramWizardContributor.label = Enterprise Manageability diagram
889
TogafEnterpriseManageabilityDiagramWizardContributor.icon =  res/bmp/profile/togafenterprisemanageabilitydiagram16.png
890
TogafEnterpriseManageabilityDiagramWizardContributor.info =  Enterprise Manageability diagram
891
TogafEnterpriseManageabilityDiagramWizardContributor.detail =  The Enterprise Manageability diagram shows how one or more applications interact with application and technology components that support operational management of a solution.
892
TogafEnterpriseManageabilityDiagramWizardContributor.preview =  res/bmp/profile/togafenterprisemanageabilitydiagrampreview.png
893
TogafProcessSystemRealizationDiagramWizardContributor.label = Process System Realization diagram
894
TogafProcessSystemRealizationDiagramWizardContributor.icon =  res/bmp/profile/togafprocesssystemrealizationdiagram16.png
895
TogafProcessSystemRealizationDiagramWizardContributor.info =  Process System Realization diagram
896
TogafProcessSystemRealizationDiagramWizardContributor.detail = The purpose of the Process/System Realization diagram is to clearly depict the sequence of events when multiple applications are involved in executing a business process.
897
TogafProcessSystemRealizationDiagramWizardContributor.preview =  res/bmp/profile/togafprocesssystemrealizationdiagrampreview.png
898
TogafProjectContextDiagramWizardContributor.label = Project Context diagram
899
TogafProjectContextDiagramWizardContributor.icon =  res/bmp/profile/togafprojectcontextdiagram16.png
900
TogafProjectContextDiagramWizardContributor.info =  Project Context diagram
901
TogafProjectContextDiagramWizardContributor.detail =  A Project Context diagram shows the scope of a work package to be implemented as a part of a broader transformation roadmap.
902
TogafProjectContextDiagramWizardContributor.preview =  res/bmp/profile/togafprojectcontextdiagrampreview.png
903
TogafSolutionConceptDiagramWizardContributor.label = Solution Concept diagram
904
TogafSolutionConceptDiagramWizardContributor.icon =  res/bmp/profile/togafsolutionconceptdiagram16.png
905
TogafSolutionConceptDiagramWizardContributor.info =  Solution Concept diagram
906
TogafSolutionConceptDiagramWizardContributor.detail =  A Solution Concept diagram provides a high-level orientation of the solution that is envisaged in order to meet the objectives of the architecture engagement.
907
TogafSolutionConceptDiagramWizardContributor.preview =  res/bmp/profile/togafsolutionconceptdiagrampreview.png
908
TogafBenefitsDiagramWizardContributor.label = Benefits diagram
909
TogafBenefitsDiagramWizardContributor.icon =  res/bmp/profile/togafbenefitsdiagram16.png
910
TogafBenefitsDiagramWizardContributor.info =  Benefits diagram
911
TogafBenefitsDiagramWizardContributor.detail =  The Benefits diagram shows opportunities identified in an architecture definition, classified according to their relative size, benefit, and complexity.
912
TogafBenefitsDiagramWizardContributor.preview =  res/bmp/profile/togafbenefitsdiagrampreview.png
913
TogafBusinessServiceInformationDiagramWizardContributor.label = Business Service Information diagram
914
TogafBusinessServiceInformationDiagramWizardContributor.icon =  res/bmp/profile/businessserviceinformationdiagram16.png
915
TogafBusinessServiceInformationDiagramWizardContributor.info =  Business Service Information diagram
916
TogafBusinessServiceInformationDiagramWizardContributor.detail = The Business Service/Information diagram shows the information needed to support one or more business services.
917
TogafBusinessServiceInformationDiagramWizardContributor.preview =  res/bmp/profile/businessserviceinformationdiagrampreview.png
918
TogafUseCaseDiagramWizardContributor.label = Use Case diagram
919
TogafUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafusecasediagram16.png
920
TogafUseCaseDiagramWizardContributor.info =  Use Case diagram
921
TogafUseCaseDiagramWizardContributor.detail =  A Use-Case diagram displays the relationships between consumers and providers of Services.
922
TogafUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafusecasediagrampreview.png
923
ServiceDataDiagramWizardContributor.label = Logical Data diagram
924
ServiceDataDiagramWizardContributor.icon =  res/bmp/profile/servicedatadiagram16.png
925
ServiceDataDiagramWizardContributor.info =  Logical Data diagram
926
ServiceDataDiagramWizardContributor.detail =  Messages need a dedicated model and definition.
927
ServiceDataDiagramWizardContributor.preview =  res/bmp/profile/servicedatadiagrampreview.png
928
SoftwareEngineeringDiagramWizardContributor.label = Software Engineering diagram
929
SoftwareEngineeringDiagramWizardContributor.icon =  res/bmp/modelio/softwareengineering16.png
930
SoftwareEngineeringDiagramWizardContributor.info =  Software Engineering diagram
931
SoftwareEngineeringDiagramWizardContributor.detail =  The purpose of Software Engineering diagrams is to define TOGAF Software Engineering
932
SoftwareDistributionDiagramWizardContributor.label = Software Distribution diagram
933
SoftwareDistributionDiagramWizardContributor.icon =  res/bmp/modelio/softwaredistribution16.png
934
SoftwareDistributionDiagramWizardContributor.info =  Software Distribution diagram
935
SoftwareDistributionDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
936
SoftwareDistributionDiagramWizardContributor.preview =  res/bmp/profile/softwaredistributionpreview.png
937
TogafProcessFlowDiagramWizardContributor.label = Process Flow diagram
938
TogafProcessFlowDiagramWizardContributor.icon =  res/bmp/profile/processflowdiagram16.png
939
TogafProcessFlowDiagramWizardContributor.info =  Process Flow diagram
940
TogafProcessFlowDiagramWizardContributor.detail =  Business Process modeling is done using business process diagrams.\nThe purpose of the business process diagram is to depict all models and mappings related to a process.
941
TogafProcessFlowDiagramWizardContributor.preview =  res/bmp/profile/processflowdiagrampreview.png
942
TogafFunctionalDecompositionDiagramWizardContributor.label = Functional Decomposition diagram
943
TogafFunctionalDecompositionDiagramWizardContributor.icon =  res/bmp/profile/functionaldecompositiondiagram16.png
944
TogafFunctionalDecompositionDiagramWizardContributor.info =  Togaf Functional Decomposition diagram
945
TogafFunctionalDecompositionDiagramWizardContributor.detail =  The purpose of the Functional Decomposition diagram is to show on a single page the capabilities of an organization that are relevant to the consideration of an architecture.
946
TogafFunctionalDecompositionDiagramWizardContributor.preview =  res/bmp/profile/functionaldecompositiondiagrampreview.png
947
TogafProductLifeCycleDiagramWizardContributor.label = Product Lifecycle diagram
948
TogafProductLifeCycleDiagramWizardContributor.icon =  res/bmp/profile/productlifecyclediagram16.png
949
TogafProductLifeCycleDiagramWizardContributor.info =  Product Lifecycle diagram
950
TogafProductLifeCycleDiagramWizardContributor.detail =  The purpose of the Product Lifecycle diagram is to assist in understanding the lifecycles of key entities within the enterprise.
951
TogafProductLifeCycleDiagramWizardContributor.preview =  res/bmp/profile/productlifecyclediagrampreview.png
952
TogafGoalObjectiveServiceDiagramWizardContributor.label = Driver/Goal/Objectives diagram
953
TogafGoalObjectiveServiceDiagramWizardContributor.icon =  res/bmp/profile/goalobjectiveservicediagram16.png
954
TogafGoalObjectiveServiceDiagramWizardContributor.info =  Driver/Goal/Objectives diagram
955
TogafGoalObjectiveServiceDiagramWizardContributor.detail = The purpose of a Goal/Objective/Service diagram is to define the ways in which a service contributes to the achievement of a business vision or strategy.
956
TogafGoalObjectiveServiceDiagramWizardContributor.preview =  res/bmp/profile/goalobjectiveservicediagrampreview.png
957
TogafBusinessUseCaseDiagramWizardContributor.label = Business Use Case diagram
958
TogafBusinessUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafusecasediagram16.png
959
TogafBusinessUseCaseDiagramWizardContributor.info =  Business Use Case diagram
960
TogafBusinessUseCaseDiagramWizardContributor.detail =  A Business Use-Case diagram displays the relationships between consumers and providers of business services.
961
TogafBusinessUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafusecasediagrampreview.png
962
TogafOrganizationRoleDiagramWizardContributor.label = Organization Role diagram
963
TogafOrganizationRoleDiagramWizardContributor.icon =  res/bmp/profile/organizationrolediagram16.png
964
TogafOrganizationRoleDiagramWizardContributor.info =  Organization Role diagram
965
TogafOrganizationRoleDiagramWizardContributor.detail =  Diagram dedicated to the definition of participants and their responsibilities. Roles and actors are modeled here.
966
TogafOrganizationRoleDiagramWizardContributor.preview =  res/bmp/profile/organizationrolediagrampreview.png
967
TogafOrganizationDecompositionDiagramWizardContributor.label = Organization Decomposition diagram
968
TogafOrganizationDecompositionDiagramWizardContributor.icon =  res/bmp/profile/organizationdecompositiondiagram16.png
969
TogafOrganizationDecompositionDiagramWizardContributor.info =  Organization Decomposition diagram
970
TogafOrganizationDecompositionDiagramWizardContributor.detail =  An Organization diagram describes the links between actors, and locations within an organization tree.
971
TogafOrganizationDecompositionDiagramWizardContributor.preview =  res/bmp/profile/organizationdecompositiondiagrampreview.png
972
TogafEventDiagramWizardContributor.label = Event diagram
973
TogafEventDiagramWizardContributor.icon =  res/bmp/profile/togafeventdiagram16.png
974
TogafEventDiagramWizardContributor.info =  Event diagram
975
TogafEventDiagramWizardContributor.detail =  The purpose of the process map diagram is to depict the relationship between events and process, and to show an overview of the business processes.
976
TogafEventDiagramWizardContributor.preview =  res/bmp/profile/togafeventdiagrampreview.png
977
TogafDataSecurityDiagramWizardContributor.label = Data Security diagram
978
TogafDataSecurityDiagramWizardContributor.icon =  res/bmp/profile/togafdatasecuritydiagram16.png
979
TogafDataSecurityDiagramWizardContributor.info =  Data Security diagram
980
TogafDataSecurityDiagramWizardContributor.detail =  Data is considered as an asset to the enterprise and data security simply means ensuring that enterprise data is not compromised and that access to it is suitably controlled.
981
TogafDataSecurityDiagramWizardContributor.preview =  res/bmp/profile/togafdatasecuritydiagrampreview.png
982
TogafValueChainDiagramWizardContributor.label = Value Chain diagram
983
TogafValueChainDiagramWizardContributor.icon =  res/bmp/profile/togafvaluechaindiagram16.png
984
TogafValueChainDiagramWizardContributor.info =  Value Chain diagram
985
TogafValueChainDiagramWizardContributor.detail =  A Value Chain diagram provides a high-level orientation view of an enterprise and how it interacts with the outside world.
986
TogafValueChainDiagramWizardContributor.preview =  res/bmp/profile/togafvaluechaindiagrampreview.png
987
TogafLocationDiagramWizardContributor.label = Location diagram
988
TogafLocationDiagramWizardContributor.icon =  res/bmp/profile/togaflocationdiagram16.png
989
TogafLocationDiagramWizardContributor.info =  Location diagram
990
TogafLocationDiagramWizardContributor.detail =  This kind of diagram helps in formalizing the locations of an enterprise, and the distribution of platforms and business services on it.
991
TogafLocationDiagramWizardContributor.preview =  res/bmp/profile/togaflocationdiagrampreview.png
992
TogafEnvironmentAndLocationsDiagramWizardContributor.label = Environment and Locations diagram
993
TogafEnvironmentAndLocationsDiagramWizardContributor.icon =  res/bmp/profile/togafenvironmentandlocationsdiagram16.png
994
TogafEnvironmentAndLocationsDiagramWizardContributor.info =  Environment and Locations diagram
995
TogafEnvironmentAndLocationsDiagramWizardContributor.detail =  Environments and Locations diagram depicts which locations host which applications, identifies what technologies and/or applications are used at which locations, and finally identifies the locations from which business users typically interact with the applications.
996
TogafEnvironmentAndLocationsDiagramWizardContributor.preview =  res/bmp/profile/togafenvironmentandlocationsdiagrampreview.png
997
TogafNewtorkComputingHardwareDiagramWizardContributor.label = Network Computing Hardware diagram
998
TogafNewtorkComputingHardwareDiagramWizardContributor.icon =  res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png
999
TogafNewtorkComputingHardwareDiagramWizardContributor.info =  Network Computing Hardware diagram
1000
TogafNewtorkComputingHardwareDiagramWizardContributor.detail =  Representation of the deployment of service components to computing devices (i.e. servers, workstations, \u2026).
1001
TogafNewtorkComputingHardwareDiagramWizardContributor.preview =  res/bmp/profile/togafnewtorkcomputinghardwarediagrampreview.png
1002
TogafPlatformDecompositionDiagramWizardContributor.label = Platform decomposition diagram
1003
TogafPlatformDecompositionDiagramWizardContributor.icon =  res/bmp/profile/togafplatformdecompositiondiagram16.png
1004
TogafPlatformDecompositionDiagramWizardContributor.info =  Platform Decomposition diagram
1005
TogafPlatformDecompositionDiagramWizardContributor.detail =  The Platform Decomposition diagram depicts the technology platform that supports the operations of the Information Systems Architecture.
1006
TogafPlatformDecompositionDiagramWizardContributor.preview =  res/bmp/profile/togafplatformdecompositiondiagrampreview.png
1007
TogafProcessingDiagramWizardContributor.label = Processing diagram
1008
TogafProcessingDiagramWizardContributor.icon =  res/bmp/profile/togafprocessingdiagram16.png
1009
TogafProcessingDiagramWizardContributor.info =  Processing diagram
1010
TogafProcessingDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
1011
TogafProcessingDiagramWizardContributor.preview = res/bmp/profile/togafprocessingdiagrampreview.png
1012
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram
1013
TogafCommunicationEngineeringDiagramsCommande.icon =  res/bmp/profile/togafcommunicationengineeringdiagrams16.png
1014
TogafCommunicationEngineeringDiagramsCommande.info =  Communication Engineering diagram
1015
TogafCommunicationEngineeringDiagramsCommande.detail =  The Communications Engineering diagram describes the means of communication, the method of sending and receiving information between these assets in the Technology Architecture; insofar as the selection of package solutions in the preceding architectures put specific requirements on the communications between the applications.
1016
TogafCommunicationEngineeringDiagramsCommande.preview =  res/bmp/profile/togafcommunicationengineeringdiagramspreview.png
1017
TogafSofwareDistributionDiagramWizardContributor.label = Software Distribution diagram
1018
TogafSofwareDistributionDiagramWizardContributor.icon =  res/bmp/profile/sofwaredistributiondiagram16.png
1019
TogafSofwareDistributionDiagramWizardContributor.info =  Software Distribution diagram
1020
TogafSofwareDistributionDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
1021
TogafSofwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png
1022
TogafMatrixDiagramWizardContributor.label = Traceability diagram
1023
TogafMatrixDiagramWizardContributor.icon =  res/bmp/profile/togafmatrixdiagram16.png
1024
TogafMatrixDiagramWizardContributor.info =  Traceability diagram
1025
TogafMatrixDiagramWizardContributor.detail =  The purpose of Matrix diagrams is to define dependencies that will produce the Excell Matrices. Matrix diagrams are also useful to define general purpose traceabilities between elements.
1026
TogafMatrixDiagramWizardContributor.preview =  res/bmp/profile/togafmatrixdiagrampreview.png
1027

    
1028

    
1029
TogafClassDiagramCommand.label = Class diagram
1030
TogafClassDiagramCommand.tooltip =  Class diagram
1031
TogafClassDiagramCommand.image =  res/bmp/profile/classdiagram16.png
1032
TogafClassHierachyDiagramCommand.label = Class Hierarchy diagram
1033
TogafClassHierachyDiagramCommand.tooltip =  Class Hierarchy diagram
1034
TogafClassHierachyDiagramCommand.image =  res/bmp/profile/classhierachydiagram16.png
1035
TogafDataLifeCycleDiagramCommand.label = Data Lifecycle diagram
1036
TogafDataLifeCycleDiagramCommand.tooltip =  Data Lifecycle diagram
1037
TogafDataLifeCycleDiagramCommand.image =  res/bmp/profile/togafdatalifecyclediagram16.png
1038
TogafApplicationAndUserLocationDiagramCommande.label = Application and User Location diagram
1039
TogafApplicationAndUserLocationDiagramCommande.tooltip =  Application and User Location diagram
1040
TogafApplicationAndUserLocationDiagramCommande.image =  res/bmp/profile/togafapplicationanduserlocationdiagram16.png
1041
TogafDataMigrationDiagramCommand.label = Data Migration diagram
1042
TogafDataMigrationDiagramCommand.tooltip =  Data Migration diagram
1043
TogafDataMigrationDiagramCommand.image =  res/bmp/profile/datamigrationdiagram16.png
1044
TogafBusinessFootPrintDiagramCommande.label = Business Footprint diagram
1045
TogafBusinessFootPrintDiagramCommande.tooltip =  Business Footprint diagram
1046
TogafBusinessFootPrintDiagramCommande.image =  res/bmp/profile/businessfootprintdiagram16.png
1047
TogafApplicationCommunicationDiagramCommande.label = Application Communication diagram
1048
TogafApplicationCommunicationDiagramCommande.tooltip =  Application Communication diagram
1049
TogafApplicationCommunicationDiagramCommande.image =  res/bmp/profile/applicationcommunicationdiagram16.png
1050
TogafSystemUseCaseDiagramCommande.label = System Use Case diagram
1051
TogafSystemUseCaseDiagramCommande.tooltip =  System Use Case diagram
1052
TogafSystemUseCaseDiagramCommande.image =  res/bmp/profile/togafsystemusecasediagram16.png
1053
TogafApplicationMigrationDiagramCommande.label = Application Migration diagram
1054
TogafApplicationMigrationDiagramCommande.tooltip =  Application Migration diagram
1055
TogafApplicationMigrationDiagramCommande.image =  res/bmp/profile/togafapplicationmigrationdiagram16.png
1056
TogafDataDisseminationDiagramCommande.label = Data Dissemination diagram
1057
TogafDataDisseminationDiagramCommande.tooltip =  Data Dissemination diagram
1058
TogafDataDisseminationDiagramCommande.image =  res/bmp/profile/togafdatadisseminationdiagram16.png
1059
TogafEnterpriseManageabilityDiagramCommande.label = Enterprise Manageability diagram
1060
TogafEnterpriseManageabilityDiagramCommande.tooltip =  Enterprise Manageability diagram
1061
TogafEnterpriseManageabilityDiagramCommande.image =  res/bmp/profile/togafenterprisemanageabilitydiagram16.png
1062
TogafProcessSystemRealizationDiagramCommande.label = Process System Realization diagram
1063
TogafProcessSystemRealizationDiagramCommande.tooltip =  Process System Realization diagram
1064
TogafProcessSystemRealizationDiagramCommande.image =  res/bmp/profile/togafprocesssystemrealizationdiagram16.png
1065
TogafProjectContextDiagramCommande.label = Project Context diagram
1066
TogafProjectContextDiagramCommande.tooltip =  Project Context diagram
1067
TogafProjectContextDiagramCommande.image =  res/bmp/profile/togafprojectcontextdiagram16.png
1068
TogafSolutionConceptDiagramCommande.label = Solution Concept diagram
1069
TogafSolutionConceptDiagramCommande.tooltip =  Solution Concept diagram
1070
TogafSolutionConceptDiagramCommande.image =  res/bmp/profile/togafsolutionconceptdiagram16.png
1071
TogafBenefitsDiagramCommande.label = Benefits diagram
1072
TogafBenefitsDiagramCommande.tooltip =  Benefits diagram
1073
TogafBenefitsDiagramCommande.image =  res/bmp/profile/togafbenefitsdiagram16.png
1074
TogafBusinessServiceInformationDiagramCommande.label = Business Service Information diagram
1075
TogafBusinessServiceInformationDiagramCommande.tooltip =  Business Service Information diagram
1076
TogafBusinessServiceInformationDiagramCommande.image =  res/bmp/profile/businessserviceinformationdiagram16.png
1077
TogafUseCaseDiagramCommande.label = Use Case diagram
1078
TogafUseCaseDiagramCommande.tooltip =  Use Case diagram
1079
TogafUseCaseDiagramCommande.image =  res/bmp/profile/togafusecasediagram16.png
1080
ServiceDataDiagramCommande.label = Logical Data diagram
1081
ServiceDataDiagramCommande.tooltip =  Logical Data diagram
1082
ServiceDataDiagramCommande.image =  res/bmp/profile/servicedatadiagram16.png
1083
SoftwareEngineeringDiagramCommande.label = Software Engineering diagram
1084
SoftwareEngineeringDiagramCommande.tooltip =  Software Engineering diagram
1085
SoftwareEngineeringDiagramCommande.image =  res/bmp/modelio/softwareengineering16.png
1086
SoftwareDistributionDiagramCommande.label = Software Distribution diagram
1087
SoftwareDistributionDiagramCommande.tooltip =  Software Distribution diagram
1088
SoftwareDistributionDiagramCommande.image =  res/bmp/modelio/softwaredistribution16.png
1089
TogafProcessFlowDiagramCommande.label = Process Flow diagram
1090
TogafProcessFlowDiagramCommande.tooltip =  Process Flow diagram
1091
TogafProcessFlowDiagramCommande.image =  res/bmp/profile/processflowdiagram16.png
1092
TogafFunctionalDecompositionDiagramCommande.label = Functional Decomposition diagram
1093
TogafFunctionalDecompositionDiagramCommande.tooltip =  Togaf Functional Decomposition diagram
1094
TogafFunctionalDecompositionDiagramCommande.image =  res/bmp/profile/functionaldecompositiondiagram16.png
1095
TogafProductLifeCycleDiagramCommande.label = Product Lifecycle diagram
1096
TogafProductLifeCycleDiagramCommande.tooltip =  Product Lifecycle diagram
1097
TogafProductLifeCycleDiagramCommande.image =  res/bmp/profile/productlifecyclediagram16.png
1098
TogafGoalObjectiveServiceDiagramCommande.label = Driver/Goal/Objectives diagram
1099
TogafGoalObjectiveServiceDiagramCommande.tooltip =  Driver/Goal/Objectives diagram
1100
TogafGoalObjectiveServiceDiagramCommande.image =  res/bmp/profile/goalobjectiveservicediagram16.png
1101
TogafBusinessUseCaseDiagramCommande.label = Business Use Case diagram
1102
TogafBusinessUseCaseDiagramCommande.tooltip =  Business Use Case diagram
1103
TogafBusinessUseCaseDiagramCommande.image =  res/bmp/profile/togafusecasediagram16.png
1104
TogafOrganizationRoleDiagramCommande.label = Organization Role diagram
1105
TogafOrganizationRoleDiagramCommande.tooltip =  Organization Role diagram
1106
TogafOrganizationRoleDiagramCommande.image =  res/bmp/profile/classhierachydiagram16.png
1107
TogafOrganizationDecompositionDiagramCommande.label = Organization Decomposition diagram
1108
TogafOrganizationDecompositionDiagramCommande.tooltip =  Organization Decomposition diagram
1109
TogafOrganizationDecompositionDiagramCommande.image =  res/bmp/profile/organizationdecompositiondiagram16.png
1110
TogafEventDiagramCommande.label = Event diagram
1111
TogafEventDiagramCommande.tooltip =  Event diagram
1112
TogafEventDiagramCommande.image =  res/bmp/profile/togafeventdiagram16.png
1113
TogafDataSecurityDiagramCommande.label = Data Security diagram
1114
TogafDataSecurityDiagramCommande.tooltip =  Data Security diagram
1115
TogafDataSecurityDiagramCommande.image =  res/bmp/profile/togafdatasecuritydiagram16.png
1116
TogafValueChainDiagramCommande.label = Value Chain diagram
1117
TogafValueChainDiagramCommande.tooltip =  Value Chain diagram
1118
TogafValueChainDiagramCommande.image =  res/bmp/profile/togafvaluechaindiagram16.png
1119
TogafLocationDiagramCommande.label = Location diagram
1120
TogafLocationDiagramCommande.tooltip =  Location diagram
1121
TogafLocationDiagramCommande.image =  res/bmp/profile/togaflocationdiagram16.png
1122
TogafEnvironmentAndLocationsDiagramCommande.label = Environment and Locations diagram
1123
TogafEnvironmentAndLocationsDiagramCommande.tooltip =  Environment and Locations diagram
1124
TogafEnvironmentAndLocationsDiagramCommande.image =  res/bmp/profile/togafenvironmentandlocationsdiagram16.png
1125
TogafNewtorkComputingHardwareDiagramCommande.label = Network Computing Hardware diagram
1126
TogafNewtorkComputingHardwareDiagramCommande.tooltip =  Network Computing Hardware diagram
1127
TogafNewtorkComputingHardwareDiagramCommande.image =  res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png
1128
TogafPlatformDecompositionDiagramCommande.label = Platform decomposition diagram
1129
TogafPlatformDecompositionDiagramCommande.tooltip =  Platform Decomposition diagram
1130
TogafPlatformDecompositionDiagramCommande.image =  res/bmp/profile/togafplatformdecompositiondiagram16.png
1131
TogafProcessingDiagramCommande.label = Processing diagram
1132
TogafProcessingDiagramCommande.tooltip =  Processing diagram
1133
TogafProcessingDiagramCommande.image =  res/bmp/profile/togafprocessingdiagram16.png
1134
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram
1135
TogafCommunicationEngineeringDiagramsCommande.tooltip =  Communication Engineering diagram
1136
TogafCommunicationEngineeringDiagramsCommande.image =  res/bmp/profile/togafcommunicationengineeringdiagrams16.png
1137
TogafSofwareDistributionDiagramCommande.label = Software Distribution diagram
1138
TogafSofwareDistributionDiagramCommande.tooltip =  Software Distribution diagram
1139
TogafSofwareDistributionDiagramCommande.image =  res/bmp/profile/sofwaredistributiondiagram16.png
1140
TogafSofwareDistributionDiagramCommande.preview = res/bmp/profile/softwaredistributionpreview.png
1141
TogafMatrixDiagramCommande.label = Traceability diagram
1142
TogafMatrixDiagramCommande.tooltip =  Traceability diagram
1143
TogafMatrixDiagramCommande.image =  res/bmp/profile/togafmatrixdiagram16.png
1144

    
1145
Diagrams.group = Togaf diagrams
1146
Diagrams.groupimage = res/bmp/profile/togafdiagram16.png
1147
TogafPropertyPage.label = Togaf
1148
TogafPropertyPage.image = res/bmp/togaf16.png