Statistics
| Revision:

root / branches / modelio3.7.x / src / main / conf / module.properties @ 245

History | View | Annotate | Download (73.2 KB)

1
ModuleLabel= Togaf Architect
2
ModuleDescription= Framework for Entreprise Architecture which provides a comprehensive approach to the design, planning, implementation, and governance of an enterprise information architecture. Version Open Source
3

    
4
command.MigrateModel.label=Migrate Model for Modelio 3.7
5
command.MigrateModel.tooltip=Migrate old annotations
6
CreateClassifier.label = Create a classifier from this instance
7
CreateClassifier.tooltip = Create a classifier from this instance
8
CreateClassifier.image =
9
CreateClassifier.group =
10
CreateClassifier.groupimage =
11
CreateClassifierByLifeline.label = Create a classifier from this instance
12
CreateClassifierByLifeline.tooltip = Create a classifier from this instance
13
CreateClassifierByLifeline.image =
14
CreateClassifierByLifeline.group =
15
CreateClassifierByLifeline.groupimage =
16
UpdateFromClassifier.label = Update instance or part from an existing classifier
17
UpdateFromClassifier.tooltip = Update instance or part from an existing classifier
18
UpdateFromClassifier.image =
19
UpdateFromClassifier.group =
20
UpdateFromClassifier.groupimage =
21
UpdateFromClassifierByLifeline.label = Update instance or part from an existing classifier
22
UpdateFromClassifierByLifeline.tooltip = Update instance or part from an existing classifier
23
UpdateFromClassifierByLifeline.image =
24
UpdateFromClassifierByLifeline.group =
25
UpdateFromClassifierByLifeline.groupimage =
26
CreateOperation.label = Create an operation from this message
27
CreateOperation.tooltip = Create an operation from this message
28
CreateOperation.image =
29
CreateOperation.group =
30
CreateOperation.groupimage =
31
CreateOperationFromTransition.label = Create an operation from this transition
32
CreateOperationFromTransition.tooltip = Create an operation from this transition
33
CreateOperationFromTransition.image =
34
CreateOperationFromTransition.group =
35
CreateOperationFromTransition.groupimage =
36
CreateAttribute.label = Create an attribute from this occurence
37
CreateAttribute.tooltip = Create an attribute from this occurence
38
CreateAttribute.image =
39
CreateAttribute.group =
40
CreateAttribute.groupimage =
41
UpdateClassesFromInterface.label = Update classes from this interface
42
UpdateClassesFromInterface.tooltip = Update classes from this interface
43
UpdateClassesFromInterface.image =
44
UpdateClassesFromInterface.group =
45
UpdateClassesFromInterface.groupimage =
46
ImplementInterfaces.label = Implement interfaces properties
47
ImplementInterfaces.tooltip = Implement interfaces properties
48
ImplementInterfaces.image =
49
ImplementInterfaces.group =
50
ImplementInterfaces.groupimage =
51
UnimplementInterfaces.label = Delete interface properties implementations
52
UnimplementInterfaces.tooltip = Delete interface properties implementations
53
UnimplementInterfaces.image =
54
UnimplementInterfaces.group =
55
UnimplementInterfaces.groupimage =
56
UpdateInternalStructure.label = Update internal structure
57
UpdateInternalStructure.tooltip = Update internal structure
58
UpdateInternalStructure.image =
59
UpdateInternalStructure.group =
60
UpdateInternalStructure.groupimage =
61
CreateStateMachineFromState.label = Create a state machine from this state
62
CreateStateMachineFromState.tooltip = Create a state machine from this state
63
CreateStateMachineFromState.image =
64
CreateStateMachineFromState.group =
65
CreateStateMachineFromState.groupimage =
66
UpdateStateFromStateMachine.label = Update state from an existing state machine
67
UpdateStateFromStateMachine.tooltip = Update state from an existing state machine
68
UpdateStateFromStateMachine.image =
69
UpdateStateFromStateMachine.group =
70
UpdateStateFromStateMachine.groupimage =
71
OpenDocument.label = Open
72
OpenDocument.tooltip = Open
73
OpenDocument.image =
74
OpenDocument.group =
75
OpenDocument.groupimage =
76
Directory.label = Directory
77
Directory.tooltip = Create a directory
78
Directory.image =
79
Directory.group =
80
Directory.groupimage =
81
Directory.label = Directory
82
Directory.tooltip = Create a directory
83
Directory.image =
84
Directory.group =
85
Directory.groupimage =
86
File.label = File
87
File.tooltip = Create a file
88
File.image =
89
File.group =
90
File.groupimage =
91
File.label = File
92
File.tooltip = Create a file
93
File.image =
94
File.group =
95
File.groupimage =
96
Mailadress.label = Mail address
97
Mailadress.tooltip = Create a mail address
98
Mailadress.image =
99
Mailadress.group =
100
Mailadress.groupimage =
101
Url.label = Url
102
Url.tooltip = Create an url
103
Url.image =
104
Url.group =
105
Url.groupimage =
106
BusinessLayer.label = Business Layer
107
BusinessLayer.tooltip = Business Layer
108
BusinessLayer.image = res/bmp/profile/businesslayer16.png
109
BusinessLayer.group =
110
BusinessLayer.groupimage =
111
ApplicationLayer.label = Application Layer
112
ApplicationLayer.tooltip = Application Layer
113
ApplicationLayer.image = res/bmp/profile/applicationlayer16.png
114
ApplicationLayer.group =
115
ApplicationLayer.groupimage =
116
BusinessEntities.label = Business Entities
117
BusinessEntities.tooltip = Business Entities
118
BusinessEntities.image = res/bmp/profile/businessentity16.png
119
BusinessEntities.group =
120
BusinessEntities.groupimage =
121
DataArchitecture.label = Data Architecture
122
DataArchitecture.tooltip = Data Architecture
123
DataArchitecture.image = res/bmp/profile/dataarchitecture16.png
124
DataArchitecture.group =
125
DataArchitecture.groupimage =
126
ApplicationArchitecture.label = Application Architecture
127
ApplicationArchitecture.tooltip = Application Architecture
128
ApplicationArchitecture.image = res/bmp/profile/applicationarchitecture16.png
129
ApplicationArchitecture.group =
130
ApplicationArchitecture.groupimage =
131
BusinessArchitecture.label = Business Architecture
132
BusinessArchitecture.tooltip = Business Architecture
133
BusinessArchitecture.image = res/bmp/profile/businessarchitecture16.png
134
BusinessArchitecture.group =
135
BusinessArchitecture.groupimage =
136
TechnologyArchitecture.label = Technology Architecture
137
TechnologyArchitecture.tooltip = Technology Architecture
138
TechnologyArchitecture.image = res/bmp/profile/technologylayer16.png
139
TechnologyArchitecture.group =
140
TechnologyArchitecture.groupimage =
141
Interaction.label = Interaction
142
Interaction.tooltip = Interaction
143
Interaction.image =
144
Interaction.group =
145
Interaction.groupimage =
146
CommunicationInteraction.label = Communication Interaction
147
CommunicationInteraction.tooltip = Communication Interaction
148
CommunicationInteraction.image =
149
CommunicationInteraction.group =
150
CommunicationInteraction.groupimage =
151
BPMNBehavior.label = BPMN Behavior
152
BPMNBehavior.tooltip = BPMN Behavior
153
BPMNBehavior.image =
154
BPMNBehavior.group =
155
BPMNBehavior.groupimage =
156
TechnologyDomain.label = Technology Domain
157
TechnologyDomain.tooltip = Technology Domain
158
TechnologyDomain.image = res/bmp/profile/technologydomain16.png
159
TechnologyDomain.group =
160
TechnologyDomain.groupimage =
161
Server.label = Server
162
Server.tooltip = Server
163
Server.image = res/bmp/profile/server16.png
164
Server.group = Device
165
Server.groupimage = res/bmp/profile/internet16.png
166
Workstation.label = Workstation
167
Workstation.tooltip = Workstation
168
Workstation.image = res/bmp/profile/workstation16.png
169
Workstation.group = Device
170
Workstation.groupimage =
171
Internet.label = Internet
172
Internet.tooltip = Internet
173
Internet.image = res/bmp/profile/internet16.png
174
Internet.group = Device
175
Internet.groupimage = res/bmp/profile/internet16.png
176
Router.label = Router
177
Router.tooltip = Router
178
Router.image = res/bmp/profile/router16.png
179
Router.group = Device
180
Router.groupimage = res/bmp/profile/internet16.png
181
Switch.label = Switch
182
Switch.tooltip = Switch
183
Switch.image = res/bmp/profile/switch16.png
184
Switch.group = Device
185
Switch.groupimage = res/bmp/profile/internet16.png
186
NetworkNode.label = Network Node
187
NetworkNode.tooltip = Network Node
188
NetworkNode.image = res/bmp/profile/networknode16.png
189
NetworkNode.group = Device
190
NetworkNode.groupimage = res/bmp/profile/internet16.png
191
TechnologyArtifact.label = Technology Artifact
192
TechnologyArtifact.tooltip = Technology Artifact
193
TechnologyArtifact.image = res/bmp/profile/artifact16.png
194
TechnologyArtifact.group =
195
TechnologyArtifact.groupimage =
196
OrganizationDomain.label = Organization Domain
197
OrganizationDomain.tooltip = Organization Domain
198
OrganizationDomain.image = res/bmp/profile/organizationsdomain16.png
199
OrganizationDomain.group = Organization
200
OrganizationDomain.groupimage = res/bmp/profile/organizationsdomain16.png
201
OrganizationUnit.label = Organization Unit
202
OrganizationUnit.tooltip = Organization Unit
203
OrganizationUnit.image = res/bmp/profile/organizationsunit16.png
204
OrganizationUnit.group = Organization
205
OrganizationUnit.groupimage =
206
ExternalActor.label = External Actor
207
ExternalActor.tooltip = External Actor
208
ExternalActor.image = res/bmp/profile/externalactor16.png
209
ExternalActor.group = Participant
210
ExternalActor.groupimage = res/bmp/profile/externalactor16.png
211
InternalActor.label = Internal Actor
212
InternalActor.tooltip = Internal Actor
213
InternalActor.image = res/bmp/profile/internalactor16.png
214
InternalActor.group = Participant
215
InternalActor.groupimage = res/bmp/profile/externalactor16.png
216
ExternalRole.label = External Role
217
ExternalRole.tooltip = External Role
218
ExternalRole.image = res/bmp/profile/externalrole16.png
219
ExternalRole.group = Participant
220
ExternalRole.groupimage = res/bmp/profile/externalactor16.png
221
InternalRole.label = Internal Role
222
InternalRole.tooltip = Internal Role
223
InternalRole.image = res/bmp/profile/internalrole16.png
224
InternalRole.group = Participant
225
InternalRole.groupimage = res/bmp/profile/externalactor16.png
226
Event.label = Event
227
Event.tooltip = Event
228
Event.image = res/bmp/profile/event16.png
229
Event.group =
230
Event.groupimage =
231
BusinessProcess.label = Business Process
232
BusinessProcess.tooltip = Business Process
233
BusinessProcess.image = res/bmp/profile/togafprocess16.png
234
BusinessProcess.group =
235
BusinessProcess.groupimage =
236
MacroProcess.label = Macro Process
237
MacroProcess.tooltip = Macro Process
238
MacroProcess.image = res/bmp/profile/macroprocessus16.png
239
MacroProcess.group =
240
MacroProcess.groupimage =
241
BusinessCollaboration.label = Business Collaboration
242
BusinessCollaboration.tooltip = Business Collaboration
243
BusinessCollaboration.image = res/bmp/profile/businesscollaboration16.png
244
BusinessCollaboration.group =
245
BusinessCollaboration.groupimage =
246
BusinessService.label = Business Service
247
BusinessService.tooltip = Business Service
248
BusinessService.image = res/bmp/profile/businessservice16.png
249
BusinessService.group =
250
BusinessService.groupimage =
251
ISService.label = IS Service
252
ISService.tooltip = IS Service
253
ISService.image = res/bmp/profile/isservice16.png
254
ISService.group =
255
ISService.groupimage =
256
Function.label = Function
257
Function.tooltip = Function
258
Function.image = res/bmp/profile/functionservice16.png
259
Function.group =
260
Function.groupimage =
261
Product.label = Product
262
Product.tooltip = Product
263
Product.image = res/bmp/profile/togafproduct16.png
264
Product.group =
265
Product.groupimage =
266
BusinessCapability.label = Business Capability
267
BusinessCapability.tooltip = Business Capability
268
BusinessCapability.image = res/bmp/profile/businesscapabilityservice16.png
269
BusinessCapability.group =
270
BusinessCapability.groupimage =
271
Operation.label = Operation
272
Operation.tooltip = Operation
273
Operation.image = res/bmp/profile/businessserviceoperation16.png
274
Operation.group =
275
Operation.groupimage =
276
ISServiceOperation.label = IS Service Operation
277
ISServiceOperation.tooltip = IS Service Operation
278
ISServiceOperation.image = res/bmp/profile/isserviceoperation16.png
279
ISServiceOperation.group =
280
ISServiceOperation.groupimage =
281
Location.label = Location
282
Location.tooltip = Location
283
Location.image = res/bmp/profile/location16.png
284
Location.group = Location
285
Location.groupimage = res/bmp/profile/location16.png
286
Headquarter.label = Headquarter
287
Headquarter.tooltip = Headquarter
288
Headquarter.image = res/bmp/profile/headquarterlocation16.png
289
Headquarter.group = Location
290
Headquarter.groupimage = res/bmp/profile/location16.png
291
ServiceContract.label = Service Contract
292
ServiceContract.tooltip = Service Contract
293
ServiceContract.image = res/bmp/profile/servicecontract16.png
294
ServiceContract.group =
295
ServiceContract.groupimage =
296
ApplicationDomain.label = Application Domain
297
ApplicationDomain.tooltip = Application Domain
298
ApplicationDomain.image = res/bmp/profile/applicationdomain16.png
299
ApplicationDomain.group =
300
ApplicationDomain.groupimage =
301
System.label = System
302
System.tooltip = System
303
System.image = res/bmp/profile/system16.png
304
System.group = System/Application
305
System.groupimage = res/bmp/profile/system16.png
306
SystemFederation.label = System Federation
307
SystemFederation.tooltip = System Federation
308
SystemFederation.image = res/bmp/profile/systemfederation16.png
309
SystemFederation.group = System/Application
310
SystemFederation.groupimage = res/bmp/profile/system16.png
311
EnterpriseSystem.label = Enterprise System
312
EnterpriseSystem.tooltip = Enterprise System
313
EnterpriseSystem.image = res/bmp/profile/enterprisesystem16.png
314
EnterpriseSystem.group = System/Application
315
EnterpriseSystem.groupimage = res/bmp/profile/system16.png
316
Application.label = Application
317
Application.tooltip = Application
318
Application.image = res/bmp/profile/application16.png
319
Application.group = System/Application
320
Application.groupimage = res/bmp/profile/system16.png
321
ServiceComponent.label = Service Component
322
ServiceComponent.tooltip = Service Component
323
ServiceComponent.image = res/bmp/profile/applicationcomponent16.png
324
ServiceComponent.group = Service Component
325
ServiceComponent.groupimage = res/bmp/profile/applicationcomponent16.png
326
InteractionComponent.label = Interaction Component
327
InteractionComponent.tooltip = Interaction Component
328
InteractionComponent.image = res/bmp/profile/interactioncomponent16.png
329
InteractionComponent.group = Service Component
330
InteractionComponent.groupimage = res/bmp/profile/applicationcomponent16.png
331
ProcessComponent.label = Process Component
332
ProcessComponent.tooltip = Process Component
333
ProcessComponent.image = res/bmp/profile/processcomponent16.png
334
ProcessComponent.group = Service Component
335
ProcessComponent.groupimage = res/bmp/profile/applicationcomponent16.png
336
IntermediaryComponent.label = Intermediary Component
337
IntermediaryComponent.tooltip = Intermediary Component
338
IntermediaryComponent.image = res/bmp/profile/intermediarycomponent16.png
339
IntermediaryComponent.group = Service Component
340
IntermediaryComponent.groupimage = res/bmp/profile/applicationcomponent16.png
341
PublicComponent.label = Public Component
342
PublicComponent.tooltip = Public Component
343
PublicComponent.image = res/bmp/profile/publiccomponent16.png
344
PublicComponent.group = Service Component
345
PublicComponent.groupimage = res/bmp/profile/applicationcomponent16.png
346
UtilityComponent.label = Utility Component
347
UtilityComponent.tooltip = Utility Component
348
UtilityComponent.image = res/bmp/profile/utilitycomponent16.png
349
UtilityComponent.group = Service Component
350
UtilityComponent.groupimage = res/bmp/profile/applicationcomponent16.png
351
EntityComponent.label = Entity Component
352
EntityComponent.tooltip = Entity Component
353
EntityComponent.image = res/bmp/profile/entitycomponent16.png
354
EntityComponent.group = Service Component
355
EntityComponent.groupimage = res/bmp/profile/applicationcomponent16.png
356
Database.label = Database
357
Database.tooltip = Database
358
Database.image = res/bmp/profile/databaseapplicationcomponent16.png
359
Database.group = Service Component
360
Database.groupimage = res/bmp/profile/applicationcomponent16.png
361
ApplicationCollaboration.label = Application Collaboration
362
ApplicationCollaboration.tooltip = Application Collaboration
363
ApplicationCollaboration.image = res/bmp/profile/applicationcollaboration16.png
364
ApplicationCollaboration.group =
365
ApplicationCollaboration.groupimage =
366
ApplicationInstance.label = Application Instance
367
ApplicationInstance.tooltip = Application Instance
368
ApplicationInstance.image = res/bmp/profile/applicationcomponentinstance16.png
369
ApplicationInstance.group =
370
ApplicationInstance.groupimage =
371
Message.label = Message
372
Message.tooltip = Message
373
Message.image = res/bmp/profile/servicedata16.png
374
Message.group =
375
Message.groupimage =
376
MessageFragment.label = Message Fragment
377
MessageFragment.tooltip = Message Fragment
378
MessageFragment.image = res/bmp/profile/servicedatafragment16.png
379
MessageFragment.group =
380
MessageFragment.groupimage =
381
ApplicationAttribute.label = Application Attribute
382
ApplicationAttribute.tooltip = Application Attribute
383
ApplicationAttribute.image = res/bmp/profile/businessattribute16.png
384
ApplicationAttribute.group =
385
ApplicationAttribute.groupimage =
386
ApplicationOperation.label = Application Operation
387
ApplicationOperation.tooltip = Application Operation
388
ApplicationOperation.image = res/bmp/profile/businessoperation16.png
389
ApplicationOperation.group =
390
ApplicationOperation.groupimage =
391
Provided.label = Provided
392
Provided.tooltip = Provided
393
Provided.image = res/bmp/profile/serviceaccessprovide16.png
394
Provided.group =
395
Provided.groupimage =
396
Required.label = Required
397
Required.tooltip = Required
398
Required.image = res/bmp/profile/serviceaccessrequired16.png
399
Required.group =
400
Required.groupimage =
401
InformationDomain.label = Information Domain
402
InformationDomain.tooltip = Information Domain
403
InformationDomain.image = res/bmp/profile/businessdomain16.png
404
InformationDomain.group =
405
InformationDomain.groupimage =
406
BusinessEntity.label = Business Entity
407
BusinessEntity.tooltip = Business Entity
408
BusinessEntity.image = res/bmp/profile/businessentitys16.png
409
BusinessEntity.group =
410
BusinessEntity.groupimage =
411
Attribute.label = Attribute
412
Attribute.tooltip = Attribute
413
Attribute.image = res/bmp/profile/businessattribute16.png
414
Attribute.group =
415
Attribute.groupimage =
416
Operation.label = Operation
417
Operation.tooltip = Operation
418
Operation.image = res/bmp/profile/businessoperation16.png
419
Operation.group =
420
Operation.groupimage =
421
Enumeration.label = Enumeration
422
Enumeration.tooltip = Enumeration
423
Enumeration.image = res/bmp/profile/businessenumeration16.png
424
Enumeration.group =
425
Enumeration.groupimage =
426
EnumerationLiteral.label = Enumeration Literal
427
EnumerationLiteral.tooltip = Enumeration Literal
428
EnumerationLiteral.image = res/bmp/modelio/umlenumerationlitteral.png
429
EnumerationLiteral.group =
430
EnumerationLiteral.groupimage =
431
BusinessDataType.label = Business Data Type
432
BusinessDataType.tooltip = Business Data Type
433
BusinessDataType.image = res/bmp/profile/businessdatatype16.png
434
BusinessDataType.group =
435
BusinessDataType.groupimage =
436
Lifecycle.label = Lifecycle
437
Lifecycle.tooltip = Lifecycle
438
Lifecycle.image = res/bmp/profile/entitylifecycle16.png
439
Lifecycle.group =
440
Lifecycle.groupimage =
441
Precondition.label = Precondition
442
Precondition.tooltip = Precondition
443
Precondition.image = res/bmp/profile/precondition16.png
444
Precondition.group =
445
Precondition.groupimage =
446
Postcondition.label = Postcondition
447
Postcondition.tooltip = Postcondition
448
Postcondition.image = res/bmp/profile/postcondition16.png
449
Postcondition.group =
450
Postcondition.groupimage =
451
Invariant.label = Invariant
452
Invariant.tooltip = Invariant
453
Invariant.image = res/bmp/profile/invariant16.png
454
Invariant.group =
455
Invariant.groupimage =
456
BusinessToExchangeDataTransformation.label = Message generation from Business Entities
457
BusinessToExchangeDataTransformation.tooltip = Message generation from Business Entities
458
BusinessToExchangeDataTransformation.image = res/bmp/exchangedatacommande16.png
459
BusinessToExchangeDataTransformation.group = Model transformation
460
BusinessToExchangeDataTransformation.groupimage = res/bmp/exchangedatacommande16.png
461
BusinessToPersistantTransformation.label = Data Model generation from Business Entities
462
BusinessToPersistantTransformation.tooltip = Data Model generation from Business Entities
463
BusinessToPersistantTransformation.image = res/bmp/businessentityscommande16.png
464
BusinessToPersistantTransformation.group = Model transformation
465
BusinessToPersistantTransformation.groupimage = res/bmp/exchangedatacommande16.png
466
ArchitectureToJavaTransformation.label = Transformation of Architecture model to Java implementation
467
ArchitectureToJavaTransformation.tooltip = Model transformation
468
ArchitectureToJavaTransformation.image = res/bmp/javacommande16.png
469
ArchitectureToJavaTransformation.group = Model transformation
470
ArchitectureToJavaTransformation.groupimage = res/bmp/exchangedatacommande16.png
471
ProductBusinessInteractionMatrix.label = Business - Interaction Matrix
472
ProductBusinessInteractionMatrix.tooltip = Business - Interaction Matrix
473
ProductBusinessInteractionMatrix.image = res/bmp/matrix16.png
474
ProductBusinessInteractionMatrix.group = Document production|Matrices
475
ProductBusinessInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
476
ProductActorRoleMatrix.label = Actor - Role Matrix
477
ProductActorRoleMatrix.tooltip = Actor - Role Matrix
478
ProductActorRoleMatrix.image = res/bmp/matrix16.png
479
ProductActorRoleMatrix.group = Document production|Matrices
480
ProductActorRoleMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
481
ProductDataEntityBusinessFunctionMatrix.label = Data Entity - Business Function Matrix
482
ProductDataEntityBusinessFunctionMatrix.tooltip = Data Entity - Business Function Matrix
483
ProductDataEntityBusinessFunctionMatrix.image = res/bmp/matrix16.png
484
ProductDataEntityBusinessFunctionMatrix.group = Document production|Matrices
485
ProductDataEntityBusinessFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
486
ProductSystemDataMatrix.label = Product - System - Data Matrix
487
ProductSystemDataMatrix.tooltip = Product - System - Data Matrix
488
ProductSystemDataMatrix.image = res/bmp/matrix16.png
489
ProductSystemDataMatrix.group = Document production|Matrices
490
ProductSystemDataMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
491
ProductSystemOrganizationMatrix.label = System - Organization Matrix
492
ProductSystemOrganizationMatrix.tooltip = Label=System - Organization Matrix
493
ProductSystemOrganizationMatrix.image = res/bmp/matrix16.png
494
ProductSystemOrganizationMatrix.group = Document production|Matrices
495
ProductSystemOrganizationMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
496
ProductRoleSystemMatrix.label = Role - System Matrix
497
ProductRoleSystemMatrix.tooltip = Role - System Matrix
498
ProductRoleSystemMatrix.image = res/bmp/matrix16.png
499
ProductRoleSystemMatrix.group = Document production|Matrices
500
ProductRoleSystemMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
501
ProductSystemFunctionMatrix.label = System - Function Matrix
502
ProductSystemFunctionMatrix.tooltip = System - Function Matrix
503
ProductSystemFunctionMatrix.image = res/bmp/matrix16.png
504
ProductSystemFunctionMatrix.group = Document production|Matrices
505
ProductSystemFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
506
ProductApplicationInteractionMatrix.label = Application - Interaction Matrix
507
ProductApplicationInteractionMatrix.tooltip = Application - Interaction Matrix
508
ProductApplicationInteractionMatrix.image = res/bmp/matrix16.png
509
ProductApplicationInteractionMatrix.group = Document production|Matrices
510
ProductApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png
511
ProductOrganizationCatalog.label = Organization Catalog
512
ProductOrganizationCatalog.tooltip = Organization Catalog
513
ProductOrganizationCatalog.image = res/bmp/catalog16.png
514
ProductOrganizationCatalog.group = Document production|Catalogs
515
ProductOrganizationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
516
ProductRoleCatalog.label = Role - Actor Catalog
517
ProductRoleCatalog.tooltip = Role - Actor Catalog
518
ProductRoleCatalog.image = res/bmp/catalog16.png
519
ProductRoleCatalog.group = Document production|Catalogs
520
ProductRoleCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
521
ProductGoalCatalog.label = Driver - Goal - Objective Catalog
522
ProductGoalCatalog.tooltip = Driver - Goal - Objective Catalog
523
ProductGoalCatalog.image = res/bmp/catalog16.png
524
ProductGoalCatalog.group = Document production|Catalogs
525
ProductGoalCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
526
ProductBusinessCatalog.label = BusinessService - Function Catalog
527
ProductBusinessCatalog.tooltip = Business Service - Function Catalog
528
ProductBusinessCatalog.image = res/bmp/catalog16.png
529
ProductBusinessCatalog.group = Document production|Catalogs
530
ProductBusinessCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
531
ProductLocationCatalog.label = Location Catalog
532
ProductLocationCatalog.tooltip = Location Catalog
533
ProductLocationCatalog.image = res/bmp/catalog16.png
534
ProductLocationCatalog.group = Document production|Catalogs
535
ProductLocationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
536
ProductProcessEventControlProductCatalog.label = Process - Event - Control - Product Catalog
537
ProductProcessEventControlProductCatalog.tooltip = Process - Event - Control - Product Catalog
538
ProductProcessEventControlProductCatalog.image = res/bmp/catalog16.png
539
ProductProcessEventControlProductCatalog.group = Document production|Catalogs
540
ProductProcessEventControlProductCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
541
BusinessEntityCatalog.label = Business Entities Catalog
542
BusinessEntityCatalog.tooltip = Business Entities Catalog
543
BusinessEntityCatalog.image = res/bmp/extensioncatalog16.png
544
BusinessEntityCatalog.group = Document production|Catalogs (Modelio)
545
BusinessEntityCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
546
UseCasesCatalog.label = Use Cases Catalog
547
UseCasesCatalog.tooltip = Use Cases Catalog
548
UseCasesCatalog.image = res/bmp/extensioncatalog16.png
549
UseCasesCatalog.group = Document production|Catalogs (Modelio)
550
UseCasesCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
551
InformationServiceCatalog.label = Information Service Catalog
552
InformationServiceCatalog.tooltip = Information Service Catalog
553
InformationServiceCatalog.image = res/bmp/extensioncatalog16.png
554
InformationServiceCatalog.group = Document production|Catalogs (Modelio)
555
InformationServiceCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
556
ComponentCatalog.label = Component Catalog
557
ComponentCatalog.tooltip = Component Catalog
558
ComponentCatalog.image = res/bmp/extensioncatalog16.png
559
ComponentCatalog.group = Document production|Catalogs (Modelio)
560
ComponentCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
561
ServiceDataCatalog.label = Service Data Catalog
562
ServiceDataCatalog.tooltip = Service Data Catalog
563
ServiceDataCatalog.image = res/bmp/extensioncatalog16.png
564
ServiceDataCatalog.group = Document production|Catalogs (Modelio)
565
ServiceDataCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png
566
CreateBusinessInteractionMatrix.label = Business - Interaction Matrix
567
CreateBusinessInteractionMatrix.tooltip = Create Business - Interaction Matrix
568
CreateBusinessInteractionMatrix.image = res/bmp/staticmatrix16.png
569
CreateBusinessInteractionMatrix.group = Traceability Matrices
570
CreateBusinessInteractionMatrix.groupimage = res/bmp/staticmatrix16.png
571
CreateActorRoleMatrix.label = Actor - Role Matrix
572
CreateActorRoleMatrix.tooltip = Create Actor - Role Matrix
573
CreateActorRoleMatrix.image = res/bmp/staticmatrix16.png
574
CreateActorRoleMatrix.group = Traceability Matrices
575
CreateActorRoleMatrix.groupimage = res/bmp/staticmatrix16.png
576
CreateDataEntityBusinessFunctionMatrix.label = DataEntity - BusinessFunction Matrix
577
CreateDataEntityBusinessFunctionMatrix.tooltip = Create DataEntity - BusinessFunction Matrix
578
CreateDataEntityBusinessFunctionMatrix.image = res/bmp/staticmatrix16.png
579
CreateDataEntityBusinessFunctionMatrix.group = Traceability Matrices
580
CreateDataEntityBusinessFunctionMatrix.groupimage = res/bmp/staticmatrix16.png
581
CreateSystemDataMatrix.label = System - Data Matrix
582
CreateSystemDataMatrix.tooltip = Create System - Data Matrix
583
CreateSystemDataMatrix.image = res/bmp/staticmatrix16.png
584
CreateSystemDataMatrix.group = Traceability Matrices
585
CreateSystemDataMatrix.groupimage = res/bmp/staticmatrix16.png
586
CreateSystemOrganizationMatrix.label = System - Organization Matrix
587
CreateSystemOrganizationMatrix.tooltip = Create System - Organization Matrix
588
CreateSystemOrganizationMatrix.image = res/bmp/staticmatrix16.png
589
CreateSystemOrganizationMatrix.group = Traceability Matrices
590
CreateSystemOrganizationMatrix.groupimage = res/bmp/staticmatrix16.png
591
CreateRoleSystemMatrix.label = Role - System Matrix
592
CreateRoleSystemMatrix.tooltip = Create Role - System Matrix
593
CreateRoleSystemMatrix.image = res/bmp/staticmatrix16.png
594
CreateRoleSystemMatrix.group = Traceability Matrices
595
CreateRoleSystemMatrix.groupimage = res/bmp/staticmatrix16.png
596
CreateSystemFunctionMatrix.label = System - Function Matrix
597
CreateSystemFunctionMatrix.tooltip = Create System - Function Matrix
598
CreateSystemFunctionMatrix.image = res/bmp/staticmatrix16.png
599
CreateSystemFunctionMatrix.group = Traceability Matrices
600
CreateSystemFunctionMatrix.groupimage = res/bmp/staticmatrix16.png
601
CreateApplicationInteractionMatrix.label = Application - Interaction Matrix
602
CreateApplicationInteractionMatrix.tooltip = Create Application - Interaction Matrix
603
CreateApplicationInteractionMatrix.image = res/bmp/staticmatrix16.png
604
CreateApplicationInteractionMatrix.group = Traceability Matrices
605
CreateApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png
606

    
607

    
608
TechnologyArchitectureDomainDiagramCommande.label = Technology Domain
609
TechnologyArchitectureDomainDiagramCommande.tooltip = Technology Domain
610
TechnologyArchitectureDomainDiagramCommande.image = res/bmp/profile/technologydomain16.png
611
DeploymentServerDiagramCommande.label = Server
612
DeploymentServerDiagramCommande.tooltip = Server
613
DeploymentServerDiagramCommande.image = res/bmp/profile/server16.png
614
DeploymentWorkStationDiagramCommande.label = Workstation
615
DeploymentWorkStationDiagramCommande.tooltip = Workstation
616
DeploymentWorkStationDiagramCommande.image = res/bmp/profile/workstation16.png
617
DeploymentInternetDiagramCommande.label = Internet
618
DeploymentInternetDiagramCommande.tooltip = Internet
619
DeploymentInternetDiagramCommande.image = res/bmp/profile/internet16.png
620
DeploymentRouterDiagramCommande.label = Router
621
DeploymentRouterDiagramCommande.tooltip = Router
622
DeploymentRouterDiagramCommande.image = res/bmp/profile/router16.png
623
DeploymentSwitchDiagramCommande.label = Switch
624
DeploymentSwitchDiagramCommande.tooltip = Switch
625
DeploymentSwitchDiagramCommande.image = res/bmp/profile/switch16.png
626
DeploymentNetworkNodeDiagramCommande.label = Network Node
627
DeploymentNetworkNodeDiagramCommande.tooltip = Network Node
628
DeploymentNetworkNodeDiagramCommande.image = res/bmp/profile/networknode16.png
629
BusinessOrganizationDomainDiagramCommande.label = Organization Domain
630
BusinessOrganizationDomainDiagramCommande.tooltip = Organization Domain
631
BusinessOrganizationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png
632
TogafExternalActorDiagramCommande.label = External Actor
633
TogafExternalActorDiagramCommande.tooltip = External Actor
634
TogafExternalActorDiagramCommande.image = res/bmp/profile/externalactor16.png
635
TogafInternalActorDiagramCommande.label = Internal Actor
636
TogafInternalActorDiagramCommande.tooltip = Internal Actor
637
TogafInternalActorDiagramCommande.image = res/bmp/profile/internalactor16.png
638
TogafExternalRoleDiagramCommande.label = External Role
639
TogafExternalRoleDiagramCommande.tooltip = External Role
640
TogafExternalRoleDiagramCommande.image = res/bmp/profile/externalrole16.png
641
TogafInternalRoleDiagramCommande.label = Internal Role
642
TogafInternalRoleDiagramCommande.tooltip = Internal Role
643
TogafInternalRoleDiagramCommande.image = res/bmp/profile/internalrole16.png
644
EventDiagramCommande.label = Event
645
EventDiagramCommande.tooltip = Event
646
EventDiagramCommande.image = res/bmp/profile/event16.png
647
TogafOrganizationUnitDiagramCommande.label = Organization Unit
648
TogafOrganizationUnitDiagramCommande.tooltip = Organization Unit
649
TogafOrganizationUnitDiagramCommande.image = res/bmp/profile/organizationsunit16.png
650
TogafProcessDiagramCommande.label = Business Process
651
TogafProcessDiagramCommande.tooltip = Business Process
652
TogafProcessDiagramCommande.image = res/bmp/profile/togafprocess16.png
653
TogafMacroProcessDiagramCommande.label = Macro Process
654
TogafMacroProcessDiagramCommande.tooltip = Macro Process
655
TogafMacroProcessDiagramCommande.image = res/bmp/profile/macroprocessus16.png
656
TogafBusinessCollaborationDiagramCommande.label = Business Collaboration
657
TogafBusinessCollaborationDiagramCommande.tooltip = Business Collaboration
658
TogafBusinessCollaborationDiagramCommande.image = res/bmp/profile/businesscollaboration16.png
659
TogafFunctionDiagramCommande.label = Function
660
TogafFunctionDiagramCommande.tooltip = Function
661
TogafFunctionDiagramCommande.image = res/bmp/profile/functionservice16.png
662
TogafBusinessServiceDiagramCommande.label = Business Service
663
TogafBusinessServiceDiagramCommande.tooltip = Business Service
664
TogafBusinessServiceDiagramCommande.image = res/bmp/profile/businessservice16.png
665
TogafBusinessCapabilityDiagramCommande.label = Business Capability
666
TogafBusinessCapabilityDiagramCommande.tooltip = Business Capability
667
TogafBusinessCapabilityDiagramCommande.image = res/bmp/profile/businesscapabilityservice16.png
668
TogafBusinessOperationDiagramCommande.label = Operation
669
TogafBusinessOperationDiagramCommande.tooltip = Operation
670
TogafBusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
671
TogafProductDiagramCommande.label = Product
672
TogafProductDiagramCommande.tooltip = Product
673
TogafProductDiagramCommande.image = res/bmp/profile/togafproduct16.png
674
LocationDiagramCommande.label = Location
675
LocationDiagramCommande.tooltip = Location
676
LocationDiagramCommande.image = res/bmp/profile/location16.png
677
HeadquarterLocationDiagramCommande.label = Headquarter
678
HeadquarterLocationDiagramCommande.tooltip = Headquarter
679
HeadquarterLocationDiagramCommande.image = res/bmp/profile/headquarterlocation16.png
680
TogafServiceContractDiagramCommande.label = Service Contract
681
TogafServiceContractDiagramCommande.tooltip = Service Contract
682
TogafServiceContractDiagramCommande.image = res/bmp/profile/servicecontract16.png
683
SystemApplicationComponentDiagramCommande.label = System
684
SystemApplicationComponentDiagramCommande.tooltip = System
685
SystemApplicationComponentDiagramCommande.image = res/bmp/profile/system16.png
686
TogafSystemFederationDiagramCommande.label = System Federation
687
TogafSystemFederationDiagramCommande.tooltip = System Federation
688
TogafSystemFederationDiagramCommande.image = res/bmp/profile/systemfederation16.png
689
TogafEnterpriseSystemDiagramCommande.label = Enterprise System
690
TogafEnterpriseSystemDiagramCommande.tooltip = Enterprise System
691
TogafEnterpriseSystemDiagramCommande.image = res/bmp/profile/enterprisesystem16.png
692
TogafApplicationDiagramCommande.label = Application
693
TogafApplicationDiagramCommande.tooltip = Application
694
TogafApplicationDiagramCommande.image = res/bmp/profile/application16.png
695
ServiceApplicationComponentDiagramCommande.label = Service Component
696
ServiceApplicationComponentDiagramCommande.tooltip = Service Component
697
ServiceApplicationComponentDiagramCommande.image = res/bmp/profile/applicationcomponent16.png
698
InteractionApplicationComponentDiagramCommande.label = Interaction Component
699
InteractionApplicationComponentDiagramCommande.tooltip = Interaction Component
700
InteractionApplicationComponentDiagramCommande.image = res/bmp/profile/interactioncomponent16.png
701
ProcessApplicationComponentDiagramCommande.label = Process Component
702
ProcessApplicationComponentDiagramCommande.tooltip = Process Component
703
ProcessApplicationComponentDiagramCommande.image = res/bmp/profile/processcomponent16.png
704
IntermediaryApplicationComponentDiagramCommande.label = Intermediary Component
705
IntermediaryApplicationComponentDiagramCommande.tooltip = Intermediary Component
706
IntermediaryApplicationComponentDiagramCommande.image = res/bmp/profile/intermediarycomponent16.png
707
PublicApplicationComponentDiagramCommande.label = Public Component
708
PublicApplicationComponentDiagramCommande.tooltip = Public Component
709
PublicApplicationComponentDiagramCommande.image = res/bmp/profile/publiccomponent16.png
710
UtilityApplicationComponentDiagramCommande.label = Utility Component
711
UtilityApplicationComponentDiagramCommande.tooltip = Utility Component
712
UtilityApplicationComponentDiagramCommande.image = res/bmp/profile/utilitycomponent16.png
713
EntityApplicationComponentDiagramCommande.label = Entity Component
714
EntityApplicationComponentDiagramCommande.tooltip = Entity Component
715
EntityApplicationComponentDiagramCommande.image = res/bmp/profile/entitycomponent16.png
716
DataBaseApplicationComponentDiagramCommande.label = Database
717
DataBaseApplicationComponentDiagramCommande.tooltip = Database
718
DataBaseApplicationComponentDiagramCommande.image = res/bmp/profile/databaseapplicationcomponent16.png
719
TogafApplicationCollaborationDiagramCommande.label = Application Collaboration
720
TogafApplicationCollaborationDiagramCommande.tooltip = Application Collaboration
721
TogafApplicationCollaborationDiagramCommande.image = res/bmp/profile/applicationcollaboration16.png
722
ProvidedServiceAccessDiagramCommande.label = Provided
723
ProvidedServiceAccessDiagramCommande.tooltip = Provided
724
ProvidedServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessprovide16.png
725
RequiredServiceAccessDiagramCommande.label = Required
726
RequiredServiceAccessDiagramCommande.tooltip = Required
727
RequiredServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessrequired16.png
728
TogafISServiceDiagramCommande.label = IS Service
729
TogafISServiceDiagramCommande.tooltip = IS Service
730
TogafISServiceDiagramCommande.image = res/bmp/profile/isservice16.png
731
TogafISServiceOperationDiagramCommande.label = IS Service Operation
732
TogafISServiceOperationDiagramCommande.tooltip = IS Service Operation
733
TogafISServiceOperationDiagramCommande.image = res/bmp/profile/isserviceoperation16.png
734
ApplicationComponentOperationDiagramCommande.label = Application Operation
735
ApplicationComponentOperationDiagramCommande.tooltip = Application Operation
736
ApplicationComponentOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
737
TogafApplicationComponentInstanceDiagramCommande.label = Application Instance
738
TogafApplicationComponentInstanceDiagramCommande.tooltip = Application Instance
739
TogafApplicationComponentInstanceDiagramCommande.image = res/bmp/profile/applicationcomponentinstance16.png
740
MessageDiagramCommande.label = Message
741
MessageDiagramCommande.tooltip = Message
742
MessageDiagramCommande.image = res/bmp/profile/servicedata16.png
743
ServiceDataFragmentDiagramCommande.label = Message Fragment
744
ServiceDataFragmentDiagramCommande.tooltip = Message Fragment
745
ServiceDataFragmentDiagramCommande.image = res/bmp/profile/servicedatafragment16.png
746
ApplicationArchitectureAttributeDiagramCommande.label = Application Attribute
747
ApplicationArchitectureAttributeDiagramCommande.tooltip = Application Attribute
748
ApplicationArchitectureAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png
749
InformationDomainDiagramCommande.label = Information Domain
750
InformationDomainDiagramCommande.tooltip = Information Domain
751
InformationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png
752
BusinessEntityDiagramCommande.label = Business Entity
753
BusinessEntityDiagramCommande.tooltip = Business Entity
754
BusinessEntityDiagramCommande.image = res/bmp/profile/businessentitys16.png
755
BusinessOperationDiagramCommande.label = Operation
756
BusinessOperationDiagramCommande.tooltip = Operation
757
BusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png
758
BusinessAttributeDiagramCommande.label = Attribute
759
BusinessAttributeDiagramCommande.tooltip = Attribute
760
BusinessAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png
761
TogafEnumerationDiagramCommande.label = Enumeration
762
TogafEnumerationDiagramCommande.tooltip = Enumeration
763
TogafEnumerationDiagramCommande.image = res/bmp/profile/businessenumeration16.png
764
UMLEnumerationLitteralDiagramCommande.label = Enumeration Literal
765
UMLEnumerationLitteralDiagramCommande.tooltip = Enumeration Literal
766
UMLEnumerationLitteralDiagramCommande.image = res/bmp/modelio/umlenumerationlitteral.png
767
BusinessDataTypeDiagramCommande.label = Business Data Type
768
BusinessDataTypeDiagramCommande.tooltip = Business Data Type
769
BusinessDataTypeDiagramCommande.image = res/bmp/profile/businessdatatype16.png
770
UMLPortDiagramCommande.label = Port
771
UMLPortDiagramCommande.tooltip = Port
772
UMLPortDiagramCommande.image = res/bmp/modelio/umlport.png
773
TogafBusDiagramCommande.label = Bus
774
TogafBusDiagramCommande.tooltip = Bus
775
TogafBusDiagramCommande.image = res/bmp/profile/togafbus16.png
776
ConnexionDiagramCommande.label = Connection
777
ConnexionDiagramCommande.tooltip = Hardware Tecnology Component/Instance -> Hardware Tecnology Component/Instance
778
ConnexionDiagramCommande.image = res/bmp/profile/connexion16.png
779
NetworkLinkDiagramCommande.label = Network Link
780
NetworkLinkDiagramCommande.tooltip = Network Link : Technology Architecture Element/Technology Architecture Element
781
NetworkLinkDiagramCommande.image = res/bmp/profile/togafnetworklink16.png
782
TogafFunctionSequenceDiagramCommande.label = Sequence
783
TogafFunctionSequenceDiagramCommande.tooltip = Function -> Function
784
TogafFunctionSequenceDiagramCommande.image = res/bmp/profile/togaffunctionsequence16.png
785
IOFlowDiagramCommande.label = Flow
786
IOFlowDiagramCommande.tooltip = Any active element<-->Product/Entity/Event
787
IOFlowDiagramCommande.image = res/bmp/profile/ioflow16.png
788
AssumesDiagramCommande.label = Assumes
789
AssumesDiagramCommande.tooltip = Actor -> Role
790
AssumesDiagramCommande.image = res/bmp/profile/assumes16.png
791
TogafConsumesDiagramCommande.label = Consumes
792
TogafConsumesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Operation/Service/Component
793
TogafConsumesDiagramCommande.image = res/bmp/profile/togafconsumes16.png
794
InitiatorDiagramCommande.label = Initiator of
795
InitiatorDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process
796
InitiatorDiagramCommande.image = res/bmp/profile/initiator16.png
797
ResponsibleDiagramCommande.label = Responsible of
798
ResponsibleDiagramCommande.tooltip = Role/Actor -> Role/Actor/Organization Unit
799
ResponsibleDiagramCommande.image = res/bmp/profile/responsible16.png
800
ParticipatesDiagramCommande.label = Participates in
801
ParticipatesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service/Service Operation
802
ParticipatesDiagramCommande.image = res/bmp/profile/participates16.png
803
CommunicatesDiagramCommande.label = Communicates with
804
CommunicatesDiagramCommande.tooltip = Role/Actor -> Role/Actor
805
CommunicatesDiagramCommande.image = res/bmp/profile/communicates16.png
806
OwnerDiagramCommande.label = Owner of
807
OwnerDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service
808
OwnerDiagramCommande.image = res/bmp/profile/owner16.png
809
ContractOfDiagramCommand.label = Contract of
810
ContractOfDiagramCommand.tooltip = Service -> Service Contract
811
ContractOfDiagramCommand.image = res/bmp/profile/contractof16.png
812
TogafParticipantDecomposition.label = Composed of
813
TogafParticipantDecomposition.tooltip = Role/Actor -> Role/Actor
814
TogafParticipantDecomposition.image = res/bmp/profile/participantdecomposition16.png
815
ServiceProcessSupportDiagramCommande.label = Supports
816
ServiceProcessSupportDiagramCommande.tooltip = Service/Service Access/Process/Component -> Service/Process
817
ServiceProcessSupportDiagramCommande.image = res/bmp/profile/serviceprocesssupport16.png
818
PartDiagramCommande.label = Part
819
PartDiagramCommande.tooltip = Function <--> Function
820
PartDiagramCommande.image = res/bmp/profile/part16.png
821
TogafLocalizationDiagramCommande.label = Localization
822
TogafLocalizationDiagramCommande.tooltip = Role/Actor/Organization Unit -> Location
823
TogafLocalizationDiagramCommande.image = res/bmp/profile/togaflocalization16.png
824
TogafParticipantAllocationDiagramCommande.label = Allocated
825
TogafParticipantAllocationDiagramCommande.tooltip = Role/Actor -> Organization Unit
826
TogafParticipantAllocationDiagramCommande.image = res/bmp/profile/togafparticipantallocation16.png
827
ComponentRealizationDiagramCommande.label = Component Realization
828
ComponentRealizationDiagramCommande.tooltip = Component -> Service/Process/Use Case
829
ComponentRealizationDiagramCommande.image = res/bmp/profile/componentrealizationinitiator16.png
830
MigrationDiagramCommand.label = Migrate
831
MigrationDiagramCommand.tooltip = Migrate
832
MigrationDiagramCommand.image = res/bmp/profile/migration.png
833
UMLInformationFLowDiagramCommand.label = Information Flow
834
UMLInformationFLowDiagramCommand.tooltip = Information Flow
835
UMLInformationFLowDiagramCommand.image = res/bmp/modelio/umlinformationflow.png
836

    
837

    
838

    
839
TogafClassDiagramWizardContributor.label = Class diagram
840
TogafClassDiagramWizardContributor.icon =  res/bmp/profile/classdiagram16.png
841
TogafClassDiagramWizardContributor.info =  Class diagram
842
TogafClassDiagramWizardContributor.detail =  The key purpose of the Class diagram is to depict the relationships among the critical data entities (or classes) within the enterprise.
843
TogafClassDiagramWizardContributor.preview =  res/bmp/profile/classdiagrampreview.png
844
TogafClassHierachyDiagramWizardContributor.label = Class Hierarchy diagram
845
TogafClassHierachyDiagramWizardContributor.icon =  res/bmp/profile/classhierachydiagram16.png
846
TogafClassHierachyDiagramWizardContributor.info =  Class Hierarchy diagram
847
TogafClassHierachyDiagramWizardContributor.detail =  The purpose of the Class Hierarchy diagram is to show the technical stakeholders a perspective of the class hierarchy.
848
TogafClassHierachyDiagramWizardContributor.preview =  res/bmp/profile/classhierachydiagrampreview.png
849
TogafDataLifeCycleDiagramWizardContributor.label = Data Lifecycle diagram
850
TogafDataLifeCycleDiagramWizardContributor.icon =  res/bmp/profile/togafdatalifecyclediagram16.png
851
TogafDataLifeCycleDiagramWizardContributor.info =  Data Lifecycle diagram
852
TogafDataLifeCycleDiagramWizardContributor.detail =  The Entity Lifecycle diagram is an essential part of managing business entities throughout its lifecycle from conception until disposal within the constraints of the business process.
853
TogafDataLifeCycleDiagramWizardContributor.preview =  res/bmp/profile/togafdatalifecyclediagrampreview.png
854
TogafApplicationAndUserLocationDiagramWizardContributor.label = Application and User Location diagram
855
TogafApplicationAndUserLocationDiagramWizardContributor.icon =  res/bmp/profile/togafapplicationanduserlocationdiagram16.png
856
TogafApplicationAndUserLocationDiagramWizardContributor.info =  Application and User Location diagram
857
TogafApplicationAndUserLocationDiagramWizardContributor.detail =  The application and user location diagram shows the geographical distribution of applications.
858
TogafApplicationAndUserLocationDiagramWizardContributor.preview =  res/bmp/profile/togafapplicationanduserlocationdiagrampreview.png
859
TogafDataMigrationDiagramWizardContributor.label = Data Migration diagram
860
TogafDataMigrationDiagramWizardContributor.icon =  res/bmp/profile/datamigrationdiagram16.png
861
TogafDataMigrationDiagramWizardContributor.info =  Data Migration diagram
862
TogafDataMigrationDiagramWizardContributor.detail =  The purpose of the Data Migration diagram is to show the flow of data from the source to the target applications.
863
TogafDataMigrationDiagramWizardContributor.preview =  res/bmp/profile/datamigrationdiagrampreview.png
864
TogafBusinessFootPrintDiagramWizardContributor.label = Business Footprint diagram
865
TogafBusinessFootPrintDiagramWizardContributor.icon =  res/bmp/profile/businessfootprintdiagram16.png
866
TogafBusinessFootPrintDiagramWizardContributor.info =  Business Footprint diagram
867
TogafBusinessFootPrintDiagramWizardContributor.detail =  A Business Footprint diagram describes the links between business goals, organizational units, business functions, and services, and maps these functions to the technical components delivering the required capability.
868
TogafBusinessFootPrintDiagramWizardContributor.preview =  res/bmp/profile/businessfootprintdiagrampreview.png
869
TogafApplicationCommunicationDiagramWizardContributor.label = Application Communication diagram
870
TogafApplicationCommunicationDiagramWizardContributor.icon =  res/bmp/profile/applicationcommunicationdiagram16.png
871
TogafApplicationCommunicationDiagramWizardContributor.info =  Application Communication diagram
872
TogafApplicationCommunicationDiagramWizardContributor.detail =  The purpose of the Application Communication diagram is to depict all models and mappings related to communication between applications in the metamodel entity.
873
TogafApplicationCommunicationDiagramWizardContributor.preview =  res/bmp/profile/applicationcommunicationdiagrampreview.png
874
TogafSystemUseCaseDiagramWizardContributor.label = System Use Case diagram
875
TogafSystemUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafsystemusecasediagram16.png
876
TogafSystemUseCaseDiagramWizardContributor.info =  System Use Case diagram
877
TogafSystemUseCaseDiagramWizardContributor.detail =  A Use-Case diagram displays the relationships between consumers and providers of Services.
878
TogafSystemUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafsystemusecasediagrampreview.png
879
TogafApplicationMigrationDiagramWizardContributor.label = Application Migration diagram
880
TogafApplicationMigrationDiagramWizardContributor.icon =  res/bmp/profile/togafapplicationmigrationdiagram16.png
881
TogafApplicationMigrationDiagramWizardContributor.info =  Application Migration diagram
882
TogafApplicationMigrationDiagramWizardContributor.detail =  The Application Migration diagram identifies application migration from baseline to target application components.
883
TogafApplicationMigrationDiagramWizardContributor.preview =  res/bmp/profile/togafapplicationmigrationdiagrampreview.png
884
TogafDataDisseminationDiagramWizardContributor.label = Data Dissemination diagram
885
TogafDataDisseminationDiagramWizardContributor.icon =  res/bmp/profile/togafdatadisseminationdiagram16.png
886
TogafDataDisseminationDiagramWizardContributor.info =  Data Dissemination diagram
887
TogafDataDisseminationDiagramWizardContributor.detail =  The purpose of the Data Dissemination diagram is to show the relationship between data entities, business services, and application components.
888
TogafDataDisseminationDiagramWizardContributor.preview =  res/bmp/profile/togafdatadisseminationdiagrampreview.png
889
TogafEnterpriseManageabilityDiagramWizardContributor.label = Enterprise Manageability diagram
890
TogafEnterpriseManageabilityDiagramWizardContributor.icon =  res/bmp/profile/togafenterprisemanageabilitydiagram16.png
891
TogafEnterpriseManageabilityDiagramWizardContributor.info =  Enterprise Manageability diagram
892
TogafEnterpriseManageabilityDiagramWizardContributor.detail =  The Enterprise Manageability diagram shows how one or more applications interact with application and technology components that support operational management of a solution.
893
TogafEnterpriseManageabilityDiagramWizardContributor.preview =  res/bmp/profile/togafenterprisemanageabilitydiagrampreview.png
894
TogafProcessSystemRealizationDiagramWizardContributor.label = Process System Realization diagram
895
TogafProcessSystemRealizationDiagramWizardContributor.icon =  res/bmp/profile/togafprocesssystemrealizationdiagram16.png
896
TogafProcessSystemRealizationDiagramWizardContributor.info =  Process System Realization diagram
897
TogafProcessSystemRealizationDiagramWizardContributor.detail = The purpose of the Process/System Realization diagram is to clearly depict the sequence of events when multiple applications are involved in executing a business process.
898
TogafProcessSystemRealizationDiagramWizardContributor.preview =  res/bmp/profile/togafprocesssystemrealizationdiagrampreview.png
899
TogafProjectContextDiagramWizardContributor.label = Project Context diagram
900
TogafProjectContextDiagramWizardContributor.icon =  res/bmp/profile/togafprojectcontextdiagram16.png
901
TogafProjectContextDiagramWizardContributor.info =  Project Context diagram
902
TogafProjectContextDiagramWizardContributor.detail =  A Project Context diagram shows the scope of a work package to be implemented as a part of a broader transformation roadmap.
903
TogafProjectContextDiagramWizardContributor.preview =  res/bmp/profile/togafprojectcontextdiagrampreview.png
904
TogafSolutionConceptDiagramWizardContributor.label = Solution Concept diagram
905
TogafSolutionConceptDiagramWizardContributor.icon =  res/bmp/profile/togafsolutionconceptdiagram16.png
906
TogafSolutionConceptDiagramWizardContributor.info =  Solution Concept diagram
907
TogafSolutionConceptDiagramWizardContributor.detail =  A Solution Concept diagram provides a high-level orientation of the solution that is envisaged in order to meet the objectives of the architecture engagement.
908
TogafSolutionConceptDiagramWizardContributor.preview =  res/bmp/profile/togafsolutionconceptdiagrampreview.png
909
TogafBenefitsDiagramWizardContributor.label = Benefits diagram
910
TogafBenefitsDiagramWizardContributor.icon =  res/bmp/profile/togafbenefitsdiagram16.png
911
TogafBenefitsDiagramWizardContributor.info =  Benefits diagram
912
TogafBenefitsDiagramWizardContributor.detail =  The Benefits diagram shows opportunities identified in an architecture definition, classified according to their relative size, benefit, and complexity.
913
TogafBenefitsDiagramWizardContributor.preview =  res/bmp/profile/togafbenefitsdiagrampreview.png
914
TogafBusinessServiceInformationDiagramWizardContributor.label = Business Service Information diagram
915
TogafBusinessServiceInformationDiagramWizardContributor.icon =  res/bmp/profile/businessserviceinformationdiagram16.png
916
TogafBusinessServiceInformationDiagramWizardContributor.info =  Business Service Information diagram
917
TogafBusinessServiceInformationDiagramWizardContributor.detail = The Business Service/Information diagram shows the information needed to support one or more business services.
918
TogafBusinessServiceInformationDiagramWizardContributor.preview =  res/bmp/profile/businessserviceinformationdiagrampreview.png
919
TogafUseCaseDiagramWizardContributor.label = Use Case diagram
920
TogafUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafusecasediagram16.png
921
TogafUseCaseDiagramWizardContributor.info =  Use Case diagram
922
TogafUseCaseDiagramWizardContributor.detail =  A Use-Case diagram displays the relationships between consumers and providers of Services.
923
TogafUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafusecasediagrampreview.png
924
ServiceDataDiagramWizardContributor.label = Logical Data diagram
925
ServiceDataDiagramWizardContributor.icon =  res/bmp/profile/servicedatadiagram16.png
926
ServiceDataDiagramWizardContributor.info =  Logical Data diagram
927
ServiceDataDiagramWizardContributor.detail =  Messages need a dedicated model and definition.
928
ServiceDataDiagramWizardContributor.preview =  res/bmp/profile/servicedatadiagrampreview.png
929
SoftwareEngineeringDiagramWizardContributor.label = Software Engineering diagram
930
SoftwareEngineeringDiagramWizardContributor.icon =  res/bmp/modelio/softwareengineering16.png
931
SoftwareEngineeringDiagramWizardContributor.info =  Software Engineering diagram
932
SoftwareEngineeringDiagramWizardContributor.detail =  The purpose of Software Engineering diagrams is to define TOGAF Software Engineering
933
SoftwareDistributionDiagramWizardContributor.label = Software Distribution diagram
934
SoftwareDistributionDiagramWizardContributor.icon =  res/bmp/modelio/softwaredistribution16.png
935
SoftwareDistributionDiagramWizardContributor.info =  Software Distribution diagram
936
SoftwareDistributionDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
937
SoftwareDistributionDiagramWizardContributor.preview =  res/bmp/profile/softwaredistributionpreview.png
938
TogafProcessFlowDiagramWizardContributor.label = Process Flow diagram
939
TogafProcessFlowDiagramWizardContributor.icon =  res/bmp/profile/processflowdiagram16.png
940
TogafProcessFlowDiagramWizardContributor.info =  Process Flow diagram
941
TogafProcessFlowDiagramWizardContributor.detail =  Business Process modeling is done using business process diagrams.\nThe purpose of the business process diagram is to depict all models and mappings related to a process.
942
TogafProcessFlowDiagramWizardContributor.preview =  res/bmp/profile/processflowdiagrampreview.png
943
TogafFunctionalDecompositionDiagramWizardContributor.label = Functional Decomposition diagram
944
TogafFunctionalDecompositionDiagramWizardContributor.icon =  res/bmp/profile/functionaldecompositiondiagram16.png
945
TogafFunctionalDecompositionDiagramWizardContributor.info =  Togaf Functional Decomposition diagram
946
TogafFunctionalDecompositionDiagramWizardContributor.detail =  The purpose of the Functional Decomposition diagram is to show on a single page the capabilities of an organization that are relevant to the consideration of an architecture.
947
TogafFunctionalDecompositionDiagramWizardContributor.preview =  res/bmp/profile/functionaldecompositiondiagrampreview.png
948
TogafProductLifeCycleDiagramWizardContributor.label = Product Lifecycle diagram
949
TogafProductLifeCycleDiagramWizardContributor.icon =  res/bmp/profile/productlifecyclediagram16.png
950
TogafProductLifeCycleDiagramWizardContributor.info =  Product Lifecycle diagram
951
TogafProductLifeCycleDiagramWizardContributor.detail =  The purpose of the Product Lifecycle diagram is to assist in understanding the lifecycles of key entities within the enterprise.
952
TogafProductLifeCycleDiagramWizardContributor.preview =  res/bmp/profile/productlifecyclediagrampreview.png
953
TogafGoalObjectiveServiceDiagramWizardContributor.label = Driver/Goal/Objectives diagram
954
TogafGoalObjectiveServiceDiagramWizardContributor.icon =  res/bmp/profile/goalobjectiveservicediagram16.png
955
TogafGoalObjectiveServiceDiagramWizardContributor.info =  Driver/Goal/Objectives diagram
956
TogafGoalObjectiveServiceDiagramWizardContributor.detail = The purpose of a Goal/Objective/Service diagram is to define the ways in which a service contributes to the achievement of a business vision or strategy.
957
TogafGoalObjectiveServiceDiagramWizardContributor.preview =  res/bmp/profile/goalobjectiveservicediagrampreview.png
958
TogafBusinessUseCaseDiagramWizardContributor.label = Business Use Case diagram
959
TogafBusinessUseCaseDiagramWizardContributor.icon =  res/bmp/profile/togafusecasediagram16.png
960
TogafBusinessUseCaseDiagramWizardContributor.info =  Business Use Case diagram
961
TogafBusinessUseCaseDiagramWizardContributor.detail =  A Business Use-Case diagram displays the relationships between consumers and providers of business services.
962
TogafBusinessUseCaseDiagramWizardContributor.preview =  res/bmp/profile/togafusecasediagrampreview.png
963
TogafOrganizationRoleDiagramWizardContributor.label = Organization Role diagram
964
TogafOrganizationRoleDiagramWizardContributor.icon =  res/bmp/profile/organizationrolediagram16.png
965
TogafOrganizationRoleDiagramWizardContributor.info =  Organization Role diagram
966
TogafOrganizationRoleDiagramWizardContributor.detail =  Diagram dedicated to the definition of participants and their responsibilities. Roles and actors are modeled here.
967
TogafOrganizationRoleDiagramWizardContributor.preview =  res/bmp/profile/organizationrolediagrampreview.png
968
TogafOrganizationDecompositionDiagramWizardContributor.label = Organization Decomposition diagram
969
TogafOrganizationDecompositionDiagramWizardContributor.icon =  res/bmp/profile/organizationdecompositiondiagram16.png
970
TogafOrganizationDecompositionDiagramWizardContributor.info =  Organization Decomposition diagram
971
TogafOrganizationDecompositionDiagramWizardContributor.detail =  An Organization diagram describes the links between actors, and locations within an organization tree.
972
TogafOrganizationDecompositionDiagramWizardContributor.preview =  res/bmp/profile/organizationdecompositiondiagrampreview.png
973
TogafEventDiagramWizardContributor.label = Event diagram
974
TogafEventDiagramWizardContributor.icon =  res/bmp/profile/togafeventdiagram16.png
975
TogafEventDiagramWizardContributor.info =  Event diagram
976
TogafEventDiagramWizardContributor.detail =  The purpose of the process map diagram is to depict the relationship between events and process, and to show an overview of the business processes.
977
TogafEventDiagramWizardContributor.preview =  res/bmp/profile/togafeventdiagrampreview.png
978
TogafDataSecurityDiagramWizardContributor.label = Data Security diagram
979
TogafDataSecurityDiagramWizardContributor.icon =  res/bmp/profile/togafdatasecuritydiagram16.png
980
TogafDataSecurityDiagramWizardContributor.info =  Data Security diagram
981
TogafDataSecurityDiagramWizardContributor.detail =  Data is considered as an asset to the enterprise and data security simply means ensuring that enterprise data is not compromised and that access to it is suitably controlled.
982
TogafDataSecurityDiagramWizardContributor.preview =  res/bmp/profile/togafdatasecuritydiagrampreview.png
983
TogafValueChainDiagramWizardContributor.label = Value Chain diagram
984
TogafValueChainDiagramWizardContributor.icon =  res/bmp/profile/togafvaluechaindiagram16.png
985
TogafValueChainDiagramWizardContributor.info =  Value Chain diagram
986
TogafValueChainDiagramWizardContributor.detail =  A Value Chain diagram provides a high-level orientation view of an enterprise and how it interacts with the outside world.
987
TogafValueChainDiagramWizardContributor.preview =  res/bmp/profile/togafvaluechaindiagrampreview.png
988
TogafLocationDiagramWizardContributor.label = Location diagram
989
TogafLocationDiagramWizardContributor.icon =  res/bmp/profile/togaflocationdiagram16.png
990
TogafLocationDiagramWizardContributor.info =  Location diagram
991
TogafLocationDiagramWizardContributor.detail =  This kind of diagram helps in formalizing the locations of an enterprise, and the distribution of platforms and business services on it.
992
TogafLocationDiagramWizardContributor.preview =  res/bmp/profile/togaflocationdiagrampreview.png
993
TogafEnvironmentAndLocationsDiagramWizardContributor.label = Environment and Locations diagram
994
TogafEnvironmentAndLocationsDiagramWizardContributor.icon =  res/bmp/profile/togafenvironmentandlocationsdiagram16.png
995
TogafEnvironmentAndLocationsDiagramWizardContributor.info =  Environment and Locations diagram
996
TogafEnvironmentAndLocationsDiagramWizardContributor.detail =  Environments and Locations diagram depicts which locations host which applications, identifies what technologies and/or applications are used at which locations, and finally identifies the locations from which business users typically interact with the applications.
997
TogafEnvironmentAndLocationsDiagramWizardContributor.preview =  res/bmp/profile/togafenvironmentandlocationsdiagrampreview.png
998
TogafNewtorkComputingHardwareDiagramWizardContributor.label = Network Computing Hardware diagram
999
TogafNewtorkComputingHardwareDiagramWizardContributor.icon =  res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png
1000
TogafNewtorkComputingHardwareDiagramWizardContributor.info =  Network Computing Hardware diagram
1001
TogafNewtorkComputingHardwareDiagramWizardContributor.detail =  Representation of the deployment of service components to computing devices (i.e. servers, workstations, \u2026).
1002
TogafNewtorkComputingHardwareDiagramWizardContributor.preview =  res/bmp/profile/togafnewtorkcomputinghardwarediagrampreview.png
1003
TogafPlatformDecompositionDiagramWizardContributor.label = Platform decomposition diagram
1004
TogafPlatformDecompositionDiagramWizardContributor.icon =  res/bmp/profile/togafplatformdecompositiondiagram16.png
1005
TogafPlatformDecompositionDiagramWizardContributor.info =  Platform Decomposition diagram
1006
TogafPlatformDecompositionDiagramWizardContributor.detail =  The Platform Decomposition diagram depicts the technology platform that supports the operations of the Information Systems Architecture.
1007
TogafPlatformDecompositionDiagramWizardContributor.preview =  res/bmp/profile/togafplatformdecompositiondiagrampreview.png
1008
TogafProcessingDiagramWizardContributor.label = Processing diagram
1009
TogafProcessingDiagramWizardContributor.icon =  res/bmp/profile/togafprocessingdiagram16.png
1010
TogafProcessingDiagramWizardContributor.info =  Processing diagram
1011
TogafProcessingDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
1012
TogafProcessingDiagramWizardContributor.preview = res/bmp/profile/togafprocessingdiagrampreview.png
1013
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram
1014
TogafCommunicationEngineeringDiagramsCommande.icon =  res/bmp/profile/togafcommunicationengineeringdiagrams16.png
1015
TogafCommunicationEngineeringDiagramsCommande.info =  Communication Engineering diagram
1016
TogafCommunicationEngineeringDiagramsCommande.detail =  The Communications Engineering diagram describes the means of communication, the method of sending and receiving information between these assets in the Technology Architecture; insofar as the selection of package solutions in the preceding architectures put specific requirements on the communications between the applications.
1017
TogafCommunicationEngineeringDiagramsCommande.preview =  res/bmp/profile/togafcommunicationengineeringdiagramspreview.png
1018
TogafSofwareDistributionDiagramWizardContributor.label = Software Distribution diagram
1019
TogafSofwareDistributionDiagramWizardContributor.icon =  res/bmp/profile/sofwaredistributiondiagram16.png
1020
TogafSofwareDistributionDiagramWizardContributor.info =  Software Distribution diagram
1021
TogafSofwareDistributionDiagramWizardContributor.detail =  The Software Distribution diagram shows how application software is structured and distributed across the estate.
1022
TogafSofwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png
1023
TogafMatrixDiagramWizardContributor.label = Traceability diagram
1024
TogafMatrixDiagramWizardContributor.icon =  res/bmp/profile/togafmatrixdiagram16.png
1025
TogafMatrixDiagramWizardContributor.info =  Traceability diagram
1026
TogafMatrixDiagramWizardContributor.detail =  The purpose of Matrix diagrams is to define dependencies that will produce the Excell Matrices. Matrix diagrams are also useful to define general purpose traceabilities between elements.
1027
TogafMatrixDiagramWizardContributor.preview =  res/bmp/profile/togafmatrixdiagrampreview.png
1028

    
1029

    
1030
TogafClassDiagramCommand.label = Class diagram
1031
TogafClassDiagramCommand.tooltip =  Class diagram
1032
TogafClassDiagramCommand.image =  res/bmp/profile/classdiagram16.png
1033
TogafClassHierachyDiagramCommand.label = Class Hierarchy diagram
1034
TogafClassHierachyDiagramCommand.tooltip =  Class Hierarchy diagram
1035
TogafClassHierachyDiagramCommand.image =  res/bmp/profile/classhierachydiagram16.png
1036
TogafDataLifeCycleDiagramCommand.label = Data Lifecycle diagram
1037
TogafDataLifeCycleDiagramCommand.tooltip =  Data Lifecycle diagram
1038
TogafDataLifeCycleDiagramCommand.image =  res/bmp/profile/togafdatalifecyclediagram16.png
1039
TogafApplicationAndUserLocationDiagramCommande.label = Application and User Location diagram
1040
TogafApplicationAndUserLocationDiagramCommande.tooltip =  Application and User Location diagram
1041
TogafApplicationAndUserLocationDiagramCommande.image =  res/bmp/profile/togafapplicationanduserlocationdiagram16.png
1042
TogafDataMigrationDiagramCommand.label = Data Migration diagram
1043
TogafDataMigrationDiagramCommand.tooltip =  Data Migration diagram
1044
TogafDataMigrationDiagramCommand.image =  res/bmp/profile/datamigrationdiagram16.png
1045
TogafBusinessFootPrintDiagramCommande.label = Business Footprint diagram
1046
TogafBusinessFootPrintDiagramCommande.tooltip =  Business Footprint diagram
1047
TogafBusinessFootPrintDiagramCommande.image =  res/bmp/profile/businessfootprintdiagram16.png
1048
TogafApplicationCommunicationDiagramCommande.label = Application Communication diagram
1049
TogafApplicationCommunicationDiagramCommande.tooltip =  Application Communication diagram
1050
TogafApplicationCommunicationDiagramCommande.image =  res/bmp/profile/applicationcommunicationdiagram16.png
1051
TogafSystemUseCaseDiagramCommande.label = System Use Case diagram
1052
TogafSystemUseCaseDiagramCommande.tooltip =  System Use Case diagram
1053
TogafSystemUseCaseDiagramCommande.image =  res/bmp/profile/togafsystemusecasediagram16.png
1054
TogafApplicationMigrationDiagramCommande.label = Application Migration diagram
1055
TogafApplicationMigrationDiagramCommande.tooltip =  Application Migration diagram
1056
TogafApplicationMigrationDiagramCommande.image =  res/bmp/profile/togafapplicationmigrationdiagram16.png
1057
TogafDataDisseminationDiagramCommande.label = Data Dissemination diagram
1058
TogafDataDisseminationDiagramCommande.tooltip =  Data Dissemination diagram
1059
TogafDataDisseminationDiagramCommande.image =  res/bmp/profile/togafdatadisseminationdiagram16.png
1060
TogafEnterpriseManageabilityDiagramCommande.label = Enterprise Manageability diagram
1061
TogafEnterpriseManageabilityDiagramCommande.tooltip =  Enterprise Manageability diagram
1062
TogafEnterpriseManageabilityDiagramCommande.image =  res/bmp/profile/togafenterprisemanageabilitydiagram16.png
1063
TogafProcessSystemRealizationDiagramCommande.label = Process System Realization diagram
1064
TogafProcessSystemRealizationDiagramCommande.tooltip =  Process System Realization diagram
1065
TogafProcessSystemRealizationDiagramCommande.image =  res/bmp/profile/togafprocesssystemrealizationdiagram16.png
1066
TogafProjectContextDiagramCommande.label = Project Context diagram
1067
TogafProjectContextDiagramCommande.tooltip =  Project Context diagram
1068
TogafProjectContextDiagramCommande.image =  res/bmp/profile/togafprojectcontextdiagram16.png
1069
TogafSolutionConceptDiagramCommande.label = Solution Concept diagram
1070
TogafSolutionConceptDiagramCommande.tooltip =  Solution Concept diagram
1071
TogafSolutionConceptDiagramCommande.image =  res/bmp/profile/togafsolutionconceptdiagram16.png
1072
TogafBenefitsDiagramCommande.label = Benefits diagram
1073
TogafBenefitsDiagramCommande.tooltip =  Benefits diagram
1074
TogafBenefitsDiagramCommande.image =  res/bmp/profile/togafbenefitsdiagram16.png
1075
TogafBusinessServiceInformationDiagramCommande.label = Business Service Information diagram
1076
TogafBusinessServiceInformationDiagramCommande.tooltip =  Business Service Information diagram
1077
TogafBusinessServiceInformationDiagramCommande.image =  res/bmp/profile/businessserviceinformationdiagram16.png
1078
TogafUseCaseDiagramCommande.label = Use Case diagram
1079
TogafUseCaseDiagramCommande.tooltip =  Use Case diagram
1080
TogafUseCaseDiagramCommande.image =  res/bmp/profile/togafusecasediagram16.png
1081
ServiceDataDiagramCommande.label = Logical Data diagram
1082
ServiceDataDiagramCommande.tooltip =  Logical Data diagram
1083
ServiceDataDiagramCommande.image =  res/bmp/profile/servicedatadiagram16.png
1084
SoftwareEngineeringDiagramCommande.label = Software Engineering diagram
1085
SoftwareEngineeringDiagramCommande.tooltip =  Software Engineering diagram
1086
SoftwareEngineeringDiagramCommande.image =  res/bmp/modelio/softwareengineering16.png
1087
SoftwareDistributionDiagramCommande.label = Software Distribution diagram
1088
SoftwareDistributionDiagramCommande.tooltip =  Software Distribution diagram
1089
SoftwareDistributionDiagramCommande.image =  res/bmp/modelio/softwaredistribution16.png
1090
TogafProcessFlowDiagramCommande.label = Process Flow diagram
1091
TogafProcessFlowDiagramCommande.tooltip =  Process Flow diagram
1092
TogafProcessFlowDiagramCommande.image =  res/bmp/profile/processflowdiagram16.png
1093
TogafFunctionalDecompositionDiagramCommande.label = Functional Decomposition diagram
1094
TogafFunctionalDecompositionDiagramCommande.tooltip =  Togaf Functional Decomposition diagram
1095
TogafFunctionalDecompositionDiagramCommande.image =  res/bmp/profile/functionaldecompositiondiagram16.png
1096
TogafProductLifeCycleDiagramCommande.label = Product Lifecycle diagram
1097
TogafProductLifeCycleDiagramCommande.tooltip =  Product Lifecycle diagram
1098
TogafProductLifeCycleDiagramCommande.image =  res/bmp/profile/productlifecyclediagram16.png
1099
TogafGoalObjectiveServiceDiagramCommande.label = Driver/Goal/Objectives diagram
1100
TogafGoalObjectiveServiceDiagramCommande.tooltip =  Driver/Goal/Objectives diagram
1101
TogafGoalObjectiveServiceDiagramCommande.image =  res/bmp/profile/goalobjectiveservicediagram16.png
1102
TogafBusinessUseCaseDiagramCommande.label = Business Use Case diagram
1103
TogafBusinessUseCaseDiagramCommande.tooltip =  Business Use Case diagram
1104
TogafBusinessUseCaseDiagramCommande.image =  res/bmp/profile/togafusecasediagram16.png
1105
TogafOrganizationRoleDiagramCommande.label = Organization Role diagram
1106
TogafOrganizationRoleDiagramCommande.tooltip =  Organization Role diagram
1107
TogafOrganizationRoleDiagramCommande.image =  res/bmp/profile/classhierachydiagram16.png
1108
TogafOrganizationDecompositionDiagramCommande.label = Organization Decomposition diagram
1109
TogafOrganizationDecompositionDiagramCommande.tooltip =  Organization Decomposition diagram
1110
TogafOrganizationDecompositionDiagramCommande.image =  res/bmp/profile/organizationdecompositiondiagram16.png
1111
TogafEventDiagramCommande.label = Event diagram
1112
TogafEventDiagramCommande.tooltip =  Event diagram
1113
TogafEventDiagramCommande.image =  res/bmp/profile/togafeventdiagram16.png
1114
TogafDataSecurityDiagramCommande.label = Data Security diagram
1115
TogafDataSecurityDiagramCommande.tooltip =  Data Security diagram
1116
TogafDataSecurityDiagramCommande.image =  res/bmp/profile/togafdatasecuritydiagram16.png
1117
TogafValueChainDiagramCommande.label = Value Chain diagram
1118
TogafValueChainDiagramCommande.tooltip =  Value Chain diagram
1119
TogafValueChainDiagramCommande.image =  res/bmp/profile/togafvaluechaindiagram16.png
1120
TogafLocationDiagramCommande.label = Location diagram
1121
TogafLocationDiagramCommande.tooltip =  Location diagram
1122
TogafLocationDiagramCommande.image =  res/bmp/profile/togaflocationdiagram16.png
1123
TogafEnvironmentAndLocationsDiagramCommande.label = Environment and Locations diagram
1124
TogafEnvironmentAndLocationsDiagramCommande.tooltip =  Environment and Locations diagram
1125
TogafEnvironmentAndLocationsDiagramCommande.image =  res/bmp/profile/togafenvironmentandlocationsdiagram16.png
1126
TogafNewtorkComputingHardwareDiagramCommande.label = Network Computing Hardware diagram
1127
TogafNewtorkComputingHardwareDiagramCommande.tooltip =  Network Computing Hardware diagram
1128
TogafNewtorkComputingHardwareDiagramCommande.image =  res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png
1129
TogafPlatformDecompositionDiagramCommande.label = Platform decomposition diagram
1130
TogafPlatformDecompositionDiagramCommande.tooltip =  Platform Decomposition diagram
1131
TogafPlatformDecompositionDiagramCommande.image =  res/bmp/profile/togafplatformdecompositiondiagram16.png
1132
TogafProcessingDiagramCommande.label = Processing diagram
1133
TogafProcessingDiagramCommande.tooltip =  Processing diagram
1134
TogafProcessingDiagramCommande.image =  res/bmp/profile/togafprocessingdiagram16.png
1135
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram
1136
TogafCommunicationEngineeringDiagramsCommande.tooltip =  Communication Engineering diagram
1137
TogafCommunicationEngineeringDiagramsCommande.image =  res/bmp/profile/togafcommunicationengineeringdiagrams16.png
1138
TogafSofwareDistributionDiagramCommande.label = Software Distribution diagram
1139
TogafSofwareDistributionDiagramCommande.tooltip =  Software Distribution diagram
1140
TogafSofwareDistributionDiagramCommande.image =  res/bmp/profile/sofwaredistributiondiagram16.png
1141
TogafSofwareDistributionDiagramCommande.preview = res/bmp/profile/softwaredistributionpreview.png
1142
TogafMatrixDiagramCommande.label = Traceability diagram
1143
TogafMatrixDiagramCommande.tooltip =  Traceability diagram
1144
TogafMatrixDiagramCommande.image =  res/bmp/profile/togafmatrixdiagram16.png
1145

    
1146
Diagrams.group = Togaf diagrams
1147
Diagrams.groupimage = res/bmp/profile/togafdiagram16.png
1148
TogafPropertyPage.label = Togaf
1149
TogafPropertyPage.image = res/bmp/togaf16.png