root / branches / modelio3.7.x / src / main / conf / module.properties @ 245
History | View | Annotate | Download (73.2 KB)
1 |
ModuleLabel= Togaf Architect |
---|---|
2 |
ModuleDescription= Framework for Entreprise Architecture which provides a comprehensive approach to the design, planning, implementation, and governance of an enterprise information architecture. Version Open Source |
3 |
|
4 |
command.MigrateModel.label=Migrate Model for Modelio 3.7 |
5 |
command.MigrateModel.tooltip=Migrate old annotations |
6 |
CreateClassifier.label = Create a classifier from this instance |
7 |
CreateClassifier.tooltip = Create a classifier from this instance |
8 |
CreateClassifier.image = |
9 |
CreateClassifier.group = |
10 |
CreateClassifier.groupimage = |
11 |
CreateClassifierByLifeline.label = Create a classifier from this instance |
12 |
CreateClassifierByLifeline.tooltip = Create a classifier from this instance |
13 |
CreateClassifierByLifeline.image = |
14 |
CreateClassifierByLifeline.group = |
15 |
CreateClassifierByLifeline.groupimage = |
16 |
UpdateFromClassifier.label = Update instance or part from an existing classifier |
17 |
UpdateFromClassifier.tooltip = Update instance or part from an existing classifier |
18 |
UpdateFromClassifier.image = |
19 |
UpdateFromClassifier.group = |
20 |
UpdateFromClassifier.groupimage = |
21 |
UpdateFromClassifierByLifeline.label = Update instance or part from an existing classifier |
22 |
UpdateFromClassifierByLifeline.tooltip = Update instance or part from an existing classifier |
23 |
UpdateFromClassifierByLifeline.image = |
24 |
UpdateFromClassifierByLifeline.group = |
25 |
UpdateFromClassifierByLifeline.groupimage = |
26 |
CreateOperation.label = Create an operation from this message |
27 |
CreateOperation.tooltip = Create an operation from this message |
28 |
CreateOperation.image = |
29 |
CreateOperation.group = |
30 |
CreateOperation.groupimage = |
31 |
CreateOperationFromTransition.label = Create an operation from this transition |
32 |
CreateOperationFromTransition.tooltip = Create an operation from this transition |
33 |
CreateOperationFromTransition.image = |
34 |
CreateOperationFromTransition.group = |
35 |
CreateOperationFromTransition.groupimage = |
36 |
CreateAttribute.label = Create an attribute from this occurence |
37 |
CreateAttribute.tooltip = Create an attribute from this occurence |
38 |
CreateAttribute.image = |
39 |
CreateAttribute.group = |
40 |
CreateAttribute.groupimage = |
41 |
UpdateClassesFromInterface.label = Update classes from this interface |
42 |
UpdateClassesFromInterface.tooltip = Update classes from this interface |
43 |
UpdateClassesFromInterface.image = |
44 |
UpdateClassesFromInterface.group = |
45 |
UpdateClassesFromInterface.groupimage = |
46 |
ImplementInterfaces.label = Implement interfaces properties |
47 |
ImplementInterfaces.tooltip = Implement interfaces properties |
48 |
ImplementInterfaces.image = |
49 |
ImplementInterfaces.group = |
50 |
ImplementInterfaces.groupimage = |
51 |
UnimplementInterfaces.label = Delete interface properties implementations |
52 |
UnimplementInterfaces.tooltip = Delete interface properties implementations |
53 |
UnimplementInterfaces.image = |
54 |
UnimplementInterfaces.group = |
55 |
UnimplementInterfaces.groupimage = |
56 |
UpdateInternalStructure.label = Update internal structure |
57 |
UpdateInternalStructure.tooltip = Update internal structure |
58 |
UpdateInternalStructure.image = |
59 |
UpdateInternalStructure.group = |
60 |
UpdateInternalStructure.groupimage = |
61 |
CreateStateMachineFromState.label = Create a state machine from this state |
62 |
CreateStateMachineFromState.tooltip = Create a state machine from this state |
63 |
CreateStateMachineFromState.image = |
64 |
CreateStateMachineFromState.group = |
65 |
CreateStateMachineFromState.groupimage = |
66 |
UpdateStateFromStateMachine.label = Update state from an existing state machine |
67 |
UpdateStateFromStateMachine.tooltip = Update state from an existing state machine |
68 |
UpdateStateFromStateMachine.image = |
69 |
UpdateStateFromStateMachine.group = |
70 |
UpdateStateFromStateMachine.groupimage = |
71 |
OpenDocument.label = Open |
72 |
OpenDocument.tooltip = Open |
73 |
OpenDocument.image = |
74 |
OpenDocument.group = |
75 |
OpenDocument.groupimage = |
76 |
Directory.label = Directory |
77 |
Directory.tooltip = Create a directory |
78 |
Directory.image = |
79 |
Directory.group = |
80 |
Directory.groupimage = |
81 |
Directory.label = Directory |
82 |
Directory.tooltip = Create a directory |
83 |
Directory.image = |
84 |
Directory.group = |
85 |
Directory.groupimage = |
86 |
File.label = File |
87 |
File.tooltip = Create a file |
88 |
File.image = |
89 |
File.group = |
90 |
File.groupimage = |
91 |
File.label = File |
92 |
File.tooltip = Create a file |
93 |
File.image = |
94 |
File.group = |
95 |
File.groupimage = |
96 |
Mailadress.label = Mail address |
97 |
Mailadress.tooltip = Create a mail address |
98 |
Mailadress.image = |
99 |
Mailadress.group = |
100 |
Mailadress.groupimage = |
101 |
Url.label = Url |
102 |
Url.tooltip = Create an url |
103 |
Url.image = |
104 |
Url.group = |
105 |
Url.groupimage = |
106 |
BusinessLayer.label = Business Layer |
107 |
BusinessLayer.tooltip = Business Layer |
108 |
BusinessLayer.image = res/bmp/profile/businesslayer16.png |
109 |
BusinessLayer.group = |
110 |
BusinessLayer.groupimage = |
111 |
ApplicationLayer.label = Application Layer |
112 |
ApplicationLayer.tooltip = Application Layer |
113 |
ApplicationLayer.image = res/bmp/profile/applicationlayer16.png |
114 |
ApplicationLayer.group = |
115 |
ApplicationLayer.groupimage = |
116 |
BusinessEntities.label = Business Entities |
117 |
BusinessEntities.tooltip = Business Entities |
118 |
BusinessEntities.image = res/bmp/profile/businessentity16.png |
119 |
BusinessEntities.group = |
120 |
BusinessEntities.groupimage = |
121 |
DataArchitecture.label = Data Architecture |
122 |
DataArchitecture.tooltip = Data Architecture |
123 |
DataArchitecture.image = res/bmp/profile/dataarchitecture16.png |
124 |
DataArchitecture.group = |
125 |
DataArchitecture.groupimage = |
126 |
ApplicationArchitecture.label = Application Architecture |
127 |
ApplicationArchitecture.tooltip = Application Architecture |
128 |
ApplicationArchitecture.image = res/bmp/profile/applicationarchitecture16.png |
129 |
ApplicationArchitecture.group = |
130 |
ApplicationArchitecture.groupimage = |
131 |
BusinessArchitecture.label = Business Architecture |
132 |
BusinessArchitecture.tooltip = Business Architecture |
133 |
BusinessArchitecture.image = res/bmp/profile/businessarchitecture16.png |
134 |
BusinessArchitecture.group = |
135 |
BusinessArchitecture.groupimage = |
136 |
TechnologyArchitecture.label = Technology Architecture |
137 |
TechnologyArchitecture.tooltip = Technology Architecture |
138 |
TechnologyArchitecture.image = res/bmp/profile/technologylayer16.png |
139 |
TechnologyArchitecture.group = |
140 |
TechnologyArchitecture.groupimage = |
141 |
Interaction.label = Interaction |
142 |
Interaction.tooltip = Interaction |
143 |
Interaction.image = |
144 |
Interaction.group = |
145 |
Interaction.groupimage = |
146 |
CommunicationInteraction.label = Communication Interaction |
147 |
CommunicationInteraction.tooltip = Communication Interaction |
148 |
CommunicationInteraction.image = |
149 |
CommunicationInteraction.group = |
150 |
CommunicationInteraction.groupimage = |
151 |
BPMNBehavior.label = BPMN Behavior |
152 |
BPMNBehavior.tooltip = BPMN Behavior |
153 |
BPMNBehavior.image = |
154 |
BPMNBehavior.group = |
155 |
BPMNBehavior.groupimage = |
156 |
TechnologyDomain.label = Technology Domain |
157 |
TechnologyDomain.tooltip = Technology Domain |
158 |
TechnologyDomain.image = res/bmp/profile/technologydomain16.png |
159 |
TechnologyDomain.group = |
160 |
TechnologyDomain.groupimage = |
161 |
Server.label = Server |
162 |
Server.tooltip = Server |
163 |
Server.image = res/bmp/profile/server16.png |
164 |
Server.group = Device |
165 |
Server.groupimage = res/bmp/profile/internet16.png |
166 |
Workstation.label = Workstation |
167 |
Workstation.tooltip = Workstation |
168 |
Workstation.image = res/bmp/profile/workstation16.png |
169 |
Workstation.group = Device |
170 |
Workstation.groupimage = |
171 |
Internet.label = Internet |
172 |
Internet.tooltip = Internet |
173 |
Internet.image = res/bmp/profile/internet16.png |
174 |
Internet.group = Device |
175 |
Internet.groupimage = res/bmp/profile/internet16.png |
176 |
Router.label = Router |
177 |
Router.tooltip = Router |
178 |
Router.image = res/bmp/profile/router16.png |
179 |
Router.group = Device |
180 |
Router.groupimage = res/bmp/profile/internet16.png |
181 |
Switch.label = Switch |
182 |
Switch.tooltip = Switch |
183 |
Switch.image = res/bmp/profile/switch16.png |
184 |
Switch.group = Device |
185 |
Switch.groupimage = res/bmp/profile/internet16.png |
186 |
NetworkNode.label = Network Node |
187 |
NetworkNode.tooltip = Network Node |
188 |
NetworkNode.image = res/bmp/profile/networknode16.png |
189 |
NetworkNode.group = Device |
190 |
NetworkNode.groupimage = res/bmp/profile/internet16.png |
191 |
TechnologyArtifact.label = Technology Artifact |
192 |
TechnologyArtifact.tooltip = Technology Artifact |
193 |
TechnologyArtifact.image = res/bmp/profile/artifact16.png |
194 |
TechnologyArtifact.group = |
195 |
TechnologyArtifact.groupimage = |
196 |
OrganizationDomain.label = Organization Domain |
197 |
OrganizationDomain.tooltip = Organization Domain |
198 |
OrganizationDomain.image = res/bmp/profile/organizationsdomain16.png |
199 |
OrganizationDomain.group = Organization |
200 |
OrganizationDomain.groupimage = res/bmp/profile/organizationsdomain16.png |
201 |
OrganizationUnit.label = Organization Unit |
202 |
OrganizationUnit.tooltip = Organization Unit |
203 |
OrganizationUnit.image = res/bmp/profile/organizationsunit16.png |
204 |
OrganizationUnit.group = Organization |
205 |
OrganizationUnit.groupimage = |
206 |
ExternalActor.label = External Actor |
207 |
ExternalActor.tooltip = External Actor |
208 |
ExternalActor.image = res/bmp/profile/externalactor16.png |
209 |
ExternalActor.group = Participant |
210 |
ExternalActor.groupimage = res/bmp/profile/externalactor16.png |
211 |
InternalActor.label = Internal Actor |
212 |
InternalActor.tooltip = Internal Actor |
213 |
InternalActor.image = res/bmp/profile/internalactor16.png |
214 |
InternalActor.group = Participant |
215 |
InternalActor.groupimage = res/bmp/profile/externalactor16.png |
216 |
ExternalRole.label = External Role |
217 |
ExternalRole.tooltip = External Role |
218 |
ExternalRole.image = res/bmp/profile/externalrole16.png |
219 |
ExternalRole.group = Participant |
220 |
ExternalRole.groupimage = res/bmp/profile/externalactor16.png |
221 |
InternalRole.label = Internal Role |
222 |
InternalRole.tooltip = Internal Role |
223 |
InternalRole.image = res/bmp/profile/internalrole16.png |
224 |
InternalRole.group = Participant |
225 |
InternalRole.groupimage = res/bmp/profile/externalactor16.png |
226 |
Event.label = Event |
227 |
Event.tooltip = Event |
228 |
Event.image = res/bmp/profile/event16.png |
229 |
Event.group = |
230 |
Event.groupimage = |
231 |
BusinessProcess.label = Business Process |
232 |
BusinessProcess.tooltip = Business Process |
233 |
BusinessProcess.image = res/bmp/profile/togafprocess16.png |
234 |
BusinessProcess.group = |
235 |
BusinessProcess.groupimage = |
236 |
MacroProcess.label = Macro Process |
237 |
MacroProcess.tooltip = Macro Process |
238 |
MacroProcess.image = res/bmp/profile/macroprocessus16.png |
239 |
MacroProcess.group = |
240 |
MacroProcess.groupimage = |
241 |
BusinessCollaboration.label = Business Collaboration |
242 |
BusinessCollaboration.tooltip = Business Collaboration |
243 |
BusinessCollaboration.image = res/bmp/profile/businesscollaboration16.png |
244 |
BusinessCollaboration.group = |
245 |
BusinessCollaboration.groupimage = |
246 |
BusinessService.label = Business Service |
247 |
BusinessService.tooltip = Business Service |
248 |
BusinessService.image = res/bmp/profile/businessservice16.png |
249 |
BusinessService.group = |
250 |
BusinessService.groupimage = |
251 |
ISService.label = IS Service |
252 |
ISService.tooltip = IS Service |
253 |
ISService.image = res/bmp/profile/isservice16.png |
254 |
ISService.group = |
255 |
ISService.groupimage = |
256 |
Function.label = Function |
257 |
Function.tooltip = Function |
258 |
Function.image = res/bmp/profile/functionservice16.png |
259 |
Function.group = |
260 |
Function.groupimage = |
261 |
Product.label = Product |
262 |
Product.tooltip = Product |
263 |
Product.image = res/bmp/profile/togafproduct16.png |
264 |
Product.group = |
265 |
Product.groupimage = |
266 |
BusinessCapability.label = Business Capability |
267 |
BusinessCapability.tooltip = Business Capability |
268 |
BusinessCapability.image = res/bmp/profile/businesscapabilityservice16.png |
269 |
BusinessCapability.group = |
270 |
BusinessCapability.groupimage = |
271 |
Operation.label = Operation |
272 |
Operation.tooltip = Operation |
273 |
Operation.image = res/bmp/profile/businessserviceoperation16.png |
274 |
Operation.group = |
275 |
Operation.groupimage = |
276 |
ISServiceOperation.label = IS Service Operation |
277 |
ISServiceOperation.tooltip = IS Service Operation |
278 |
ISServiceOperation.image = res/bmp/profile/isserviceoperation16.png |
279 |
ISServiceOperation.group = |
280 |
ISServiceOperation.groupimage = |
281 |
Location.label = Location |
282 |
Location.tooltip = Location |
283 |
Location.image = res/bmp/profile/location16.png |
284 |
Location.group = Location |
285 |
Location.groupimage = res/bmp/profile/location16.png |
286 |
Headquarter.label = Headquarter |
287 |
Headquarter.tooltip = Headquarter |
288 |
Headquarter.image = res/bmp/profile/headquarterlocation16.png |
289 |
Headquarter.group = Location |
290 |
Headquarter.groupimage = res/bmp/profile/location16.png |
291 |
ServiceContract.label = Service Contract |
292 |
ServiceContract.tooltip = Service Contract |
293 |
ServiceContract.image = res/bmp/profile/servicecontract16.png |
294 |
ServiceContract.group = |
295 |
ServiceContract.groupimage = |
296 |
ApplicationDomain.label = Application Domain |
297 |
ApplicationDomain.tooltip = Application Domain |
298 |
ApplicationDomain.image = res/bmp/profile/applicationdomain16.png |
299 |
ApplicationDomain.group = |
300 |
ApplicationDomain.groupimage = |
301 |
System.label = System |
302 |
System.tooltip = System |
303 |
System.image = res/bmp/profile/system16.png |
304 |
System.group = System/Application |
305 |
System.groupimage = res/bmp/profile/system16.png |
306 |
SystemFederation.label = System Federation |
307 |
SystemFederation.tooltip = System Federation |
308 |
SystemFederation.image = res/bmp/profile/systemfederation16.png |
309 |
SystemFederation.group = System/Application |
310 |
SystemFederation.groupimage = res/bmp/profile/system16.png |
311 |
EnterpriseSystem.label = Enterprise System |
312 |
EnterpriseSystem.tooltip = Enterprise System |
313 |
EnterpriseSystem.image = res/bmp/profile/enterprisesystem16.png |
314 |
EnterpriseSystem.group = System/Application |
315 |
EnterpriseSystem.groupimage = res/bmp/profile/system16.png |
316 |
Application.label = Application |
317 |
Application.tooltip = Application |
318 |
Application.image = res/bmp/profile/application16.png |
319 |
Application.group = System/Application |
320 |
Application.groupimage = res/bmp/profile/system16.png |
321 |
ServiceComponent.label = Service Component |
322 |
ServiceComponent.tooltip = Service Component |
323 |
ServiceComponent.image = res/bmp/profile/applicationcomponent16.png |
324 |
ServiceComponent.group = Service Component |
325 |
ServiceComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
326 |
InteractionComponent.label = Interaction Component |
327 |
InteractionComponent.tooltip = Interaction Component |
328 |
InteractionComponent.image = res/bmp/profile/interactioncomponent16.png |
329 |
InteractionComponent.group = Service Component |
330 |
InteractionComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
331 |
ProcessComponent.label = Process Component |
332 |
ProcessComponent.tooltip = Process Component |
333 |
ProcessComponent.image = res/bmp/profile/processcomponent16.png |
334 |
ProcessComponent.group = Service Component |
335 |
ProcessComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
336 |
IntermediaryComponent.label = Intermediary Component |
337 |
IntermediaryComponent.tooltip = Intermediary Component |
338 |
IntermediaryComponent.image = res/bmp/profile/intermediarycomponent16.png |
339 |
IntermediaryComponent.group = Service Component |
340 |
IntermediaryComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
341 |
PublicComponent.label = Public Component |
342 |
PublicComponent.tooltip = Public Component |
343 |
PublicComponent.image = res/bmp/profile/publiccomponent16.png |
344 |
PublicComponent.group = Service Component |
345 |
PublicComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
346 |
UtilityComponent.label = Utility Component |
347 |
UtilityComponent.tooltip = Utility Component |
348 |
UtilityComponent.image = res/bmp/profile/utilitycomponent16.png |
349 |
UtilityComponent.group = Service Component |
350 |
UtilityComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
351 |
EntityComponent.label = Entity Component |
352 |
EntityComponent.tooltip = Entity Component |
353 |
EntityComponent.image = res/bmp/profile/entitycomponent16.png |
354 |
EntityComponent.group = Service Component |
355 |
EntityComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
356 |
Database.label = Database |
357 |
Database.tooltip = Database |
358 |
Database.image = res/bmp/profile/databaseapplicationcomponent16.png |
359 |
Database.group = Service Component |
360 |
Database.groupimage = res/bmp/profile/applicationcomponent16.png |
361 |
ApplicationCollaboration.label = Application Collaboration |
362 |
ApplicationCollaboration.tooltip = Application Collaboration |
363 |
ApplicationCollaboration.image = res/bmp/profile/applicationcollaboration16.png |
364 |
ApplicationCollaboration.group = |
365 |
ApplicationCollaboration.groupimage = |
366 |
ApplicationInstance.label = Application Instance |
367 |
ApplicationInstance.tooltip = Application Instance |
368 |
ApplicationInstance.image = res/bmp/profile/applicationcomponentinstance16.png |
369 |
ApplicationInstance.group = |
370 |
ApplicationInstance.groupimage = |
371 |
Message.label = Message |
372 |
Message.tooltip = Message |
373 |
Message.image = res/bmp/profile/servicedata16.png |
374 |
Message.group = |
375 |
Message.groupimage = |
376 |
MessageFragment.label = Message Fragment |
377 |
MessageFragment.tooltip = Message Fragment |
378 |
MessageFragment.image = res/bmp/profile/servicedatafragment16.png |
379 |
MessageFragment.group = |
380 |
MessageFragment.groupimage = |
381 |
ApplicationAttribute.label = Application Attribute |
382 |
ApplicationAttribute.tooltip = Application Attribute |
383 |
ApplicationAttribute.image = res/bmp/profile/businessattribute16.png |
384 |
ApplicationAttribute.group = |
385 |
ApplicationAttribute.groupimage = |
386 |
ApplicationOperation.label = Application Operation |
387 |
ApplicationOperation.tooltip = Application Operation |
388 |
ApplicationOperation.image = res/bmp/profile/businessoperation16.png |
389 |
ApplicationOperation.group = |
390 |
ApplicationOperation.groupimage = |
391 |
Provided.label = Provided |
392 |
Provided.tooltip = Provided |
393 |
Provided.image = res/bmp/profile/serviceaccessprovide16.png |
394 |
Provided.group = |
395 |
Provided.groupimage = |
396 |
Required.label = Required |
397 |
Required.tooltip = Required |
398 |
Required.image = res/bmp/profile/serviceaccessrequired16.png |
399 |
Required.group = |
400 |
Required.groupimage = |
401 |
InformationDomain.label = Information Domain |
402 |
InformationDomain.tooltip = Information Domain |
403 |
InformationDomain.image = res/bmp/profile/businessdomain16.png |
404 |
InformationDomain.group = |
405 |
InformationDomain.groupimage = |
406 |
BusinessEntity.label = Business Entity |
407 |
BusinessEntity.tooltip = Business Entity |
408 |
BusinessEntity.image = res/bmp/profile/businessentitys16.png |
409 |
BusinessEntity.group = |
410 |
BusinessEntity.groupimage = |
411 |
Attribute.label = Attribute |
412 |
Attribute.tooltip = Attribute |
413 |
Attribute.image = res/bmp/profile/businessattribute16.png |
414 |
Attribute.group = |
415 |
Attribute.groupimage = |
416 |
Operation.label = Operation |
417 |
Operation.tooltip = Operation |
418 |
Operation.image = res/bmp/profile/businessoperation16.png |
419 |
Operation.group = |
420 |
Operation.groupimage = |
421 |
Enumeration.label = Enumeration |
422 |
Enumeration.tooltip = Enumeration |
423 |
Enumeration.image = res/bmp/profile/businessenumeration16.png |
424 |
Enumeration.group = |
425 |
Enumeration.groupimage = |
426 |
EnumerationLiteral.label = Enumeration Literal |
427 |
EnumerationLiteral.tooltip = Enumeration Literal |
428 |
EnumerationLiteral.image = res/bmp/modelio/umlenumerationlitteral.png |
429 |
EnumerationLiteral.group = |
430 |
EnumerationLiteral.groupimage = |
431 |
BusinessDataType.label = Business Data Type |
432 |
BusinessDataType.tooltip = Business Data Type |
433 |
BusinessDataType.image = res/bmp/profile/businessdatatype16.png |
434 |
BusinessDataType.group = |
435 |
BusinessDataType.groupimage = |
436 |
Lifecycle.label = Lifecycle |
437 |
Lifecycle.tooltip = Lifecycle |
438 |
Lifecycle.image = res/bmp/profile/entitylifecycle16.png |
439 |
Lifecycle.group = |
440 |
Lifecycle.groupimage = |
441 |
Precondition.label = Precondition |
442 |
Precondition.tooltip = Precondition |
443 |
Precondition.image = res/bmp/profile/precondition16.png |
444 |
Precondition.group = |
445 |
Precondition.groupimage = |
446 |
Postcondition.label = Postcondition |
447 |
Postcondition.tooltip = Postcondition |
448 |
Postcondition.image = res/bmp/profile/postcondition16.png |
449 |
Postcondition.group = |
450 |
Postcondition.groupimage = |
451 |
Invariant.label = Invariant |
452 |
Invariant.tooltip = Invariant |
453 |
Invariant.image = res/bmp/profile/invariant16.png |
454 |
Invariant.group = |
455 |
Invariant.groupimage = |
456 |
BusinessToExchangeDataTransformation.label = Message generation from Business Entities |
457 |
BusinessToExchangeDataTransformation.tooltip = Message generation from Business Entities |
458 |
BusinessToExchangeDataTransformation.image = res/bmp/exchangedatacommande16.png |
459 |
BusinessToExchangeDataTransformation.group = Model transformation |
460 |
BusinessToExchangeDataTransformation.groupimage = res/bmp/exchangedatacommande16.png |
461 |
BusinessToPersistantTransformation.label = Data Model generation from Business Entities |
462 |
BusinessToPersistantTransformation.tooltip = Data Model generation from Business Entities |
463 |
BusinessToPersistantTransformation.image = res/bmp/businessentityscommande16.png |
464 |
BusinessToPersistantTransformation.group = Model transformation |
465 |
BusinessToPersistantTransformation.groupimage = res/bmp/exchangedatacommande16.png |
466 |
ArchitectureToJavaTransformation.label = Transformation of Architecture model to Java implementation |
467 |
ArchitectureToJavaTransformation.tooltip = Model transformation |
468 |
ArchitectureToJavaTransformation.image = res/bmp/javacommande16.png |
469 |
ArchitectureToJavaTransformation.group = Model transformation |
470 |
ArchitectureToJavaTransformation.groupimage = res/bmp/exchangedatacommande16.png |
471 |
ProductBusinessInteractionMatrix.label = Business - Interaction Matrix |
472 |
ProductBusinessInteractionMatrix.tooltip = Business - Interaction Matrix |
473 |
ProductBusinessInteractionMatrix.image = res/bmp/matrix16.png |
474 |
ProductBusinessInteractionMatrix.group = Document production|Matrices |
475 |
ProductBusinessInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
476 |
ProductActorRoleMatrix.label = Actor - Role Matrix |
477 |
ProductActorRoleMatrix.tooltip = Actor - Role Matrix |
478 |
ProductActorRoleMatrix.image = res/bmp/matrix16.png |
479 |
ProductActorRoleMatrix.group = Document production|Matrices |
480 |
ProductActorRoleMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
481 |
ProductDataEntityBusinessFunctionMatrix.label = Data Entity - Business Function Matrix |
482 |
ProductDataEntityBusinessFunctionMatrix.tooltip = Data Entity - Business Function Matrix |
483 |
ProductDataEntityBusinessFunctionMatrix.image = res/bmp/matrix16.png |
484 |
ProductDataEntityBusinessFunctionMatrix.group = Document production|Matrices |
485 |
ProductDataEntityBusinessFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
486 |
ProductSystemDataMatrix.label = Product - System - Data Matrix |
487 |
ProductSystemDataMatrix.tooltip = Product - System - Data Matrix |
488 |
ProductSystemDataMatrix.image = res/bmp/matrix16.png |
489 |
ProductSystemDataMatrix.group = Document production|Matrices |
490 |
ProductSystemDataMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
491 |
ProductSystemOrganizationMatrix.label = System - Organization Matrix |
492 |
ProductSystemOrganizationMatrix.tooltip = Label=System - Organization Matrix |
493 |
ProductSystemOrganizationMatrix.image = res/bmp/matrix16.png |
494 |
ProductSystemOrganizationMatrix.group = Document production|Matrices |
495 |
ProductSystemOrganizationMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
496 |
ProductRoleSystemMatrix.label = Role - System Matrix |
497 |
ProductRoleSystemMatrix.tooltip = Role - System Matrix |
498 |
ProductRoleSystemMatrix.image = res/bmp/matrix16.png |
499 |
ProductRoleSystemMatrix.group = Document production|Matrices |
500 |
ProductRoleSystemMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
501 |
ProductSystemFunctionMatrix.label = System - Function Matrix |
502 |
ProductSystemFunctionMatrix.tooltip = System - Function Matrix |
503 |
ProductSystemFunctionMatrix.image = res/bmp/matrix16.png |
504 |
ProductSystemFunctionMatrix.group = Document production|Matrices |
505 |
ProductSystemFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
506 |
ProductApplicationInteractionMatrix.label = Application - Interaction Matrix |
507 |
ProductApplicationInteractionMatrix.tooltip = Application - Interaction Matrix |
508 |
ProductApplicationInteractionMatrix.image = res/bmp/matrix16.png |
509 |
ProductApplicationInteractionMatrix.group = Document production|Matrices |
510 |
ProductApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
511 |
ProductOrganizationCatalog.label = Organization Catalog |
512 |
ProductOrganizationCatalog.tooltip = Organization Catalog |
513 |
ProductOrganizationCatalog.image = res/bmp/catalog16.png |
514 |
ProductOrganizationCatalog.group = Document production|Catalogs |
515 |
ProductOrganizationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
516 |
ProductRoleCatalog.label = Role - Actor Catalog |
517 |
ProductRoleCatalog.tooltip = Role - Actor Catalog |
518 |
ProductRoleCatalog.image = res/bmp/catalog16.png |
519 |
ProductRoleCatalog.group = Document production|Catalogs |
520 |
ProductRoleCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
521 |
ProductGoalCatalog.label = Driver - Goal - Objective Catalog |
522 |
ProductGoalCatalog.tooltip = Driver - Goal - Objective Catalog |
523 |
ProductGoalCatalog.image = res/bmp/catalog16.png |
524 |
ProductGoalCatalog.group = Document production|Catalogs |
525 |
ProductGoalCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
526 |
ProductBusinessCatalog.label = BusinessService - Function Catalog |
527 |
ProductBusinessCatalog.tooltip = Business Service - Function Catalog |
528 |
ProductBusinessCatalog.image = res/bmp/catalog16.png |
529 |
ProductBusinessCatalog.group = Document production|Catalogs |
530 |
ProductBusinessCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
531 |
ProductLocationCatalog.label = Location Catalog |
532 |
ProductLocationCatalog.tooltip = Location Catalog |
533 |
ProductLocationCatalog.image = res/bmp/catalog16.png |
534 |
ProductLocationCatalog.group = Document production|Catalogs |
535 |
ProductLocationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
536 |
ProductProcessEventControlProductCatalog.label = Process - Event - Control - Product Catalog |
537 |
ProductProcessEventControlProductCatalog.tooltip = Process - Event - Control - Product Catalog |
538 |
ProductProcessEventControlProductCatalog.image = res/bmp/catalog16.png |
539 |
ProductProcessEventControlProductCatalog.group = Document production|Catalogs |
540 |
ProductProcessEventControlProductCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
541 |
BusinessEntityCatalog.label = Business Entities Catalog |
542 |
BusinessEntityCatalog.tooltip = Business Entities Catalog |
543 |
BusinessEntityCatalog.image = res/bmp/extensioncatalog16.png |
544 |
BusinessEntityCatalog.group = Document production|Catalogs (Modelio) |
545 |
BusinessEntityCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
546 |
UseCasesCatalog.label = Use Cases Catalog |
547 |
UseCasesCatalog.tooltip = Use Cases Catalog |
548 |
UseCasesCatalog.image = res/bmp/extensioncatalog16.png |
549 |
UseCasesCatalog.group = Document production|Catalogs (Modelio) |
550 |
UseCasesCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
551 |
InformationServiceCatalog.label = Information Service Catalog |
552 |
InformationServiceCatalog.tooltip = Information Service Catalog |
553 |
InformationServiceCatalog.image = res/bmp/extensioncatalog16.png |
554 |
InformationServiceCatalog.group = Document production|Catalogs (Modelio) |
555 |
InformationServiceCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
556 |
ComponentCatalog.label = Component Catalog |
557 |
ComponentCatalog.tooltip = Component Catalog |
558 |
ComponentCatalog.image = res/bmp/extensioncatalog16.png |
559 |
ComponentCatalog.group = Document production|Catalogs (Modelio) |
560 |
ComponentCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
561 |
ServiceDataCatalog.label = Service Data Catalog |
562 |
ServiceDataCatalog.tooltip = Service Data Catalog |
563 |
ServiceDataCatalog.image = res/bmp/extensioncatalog16.png |
564 |
ServiceDataCatalog.group = Document production|Catalogs (Modelio) |
565 |
ServiceDataCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
566 |
CreateBusinessInteractionMatrix.label = Business - Interaction Matrix |
567 |
CreateBusinessInteractionMatrix.tooltip = Create Business - Interaction Matrix |
568 |
CreateBusinessInteractionMatrix.image = res/bmp/staticmatrix16.png |
569 |
CreateBusinessInteractionMatrix.group = Traceability Matrices |
570 |
CreateBusinessInteractionMatrix.groupimage = res/bmp/staticmatrix16.png |
571 |
CreateActorRoleMatrix.label = Actor - Role Matrix |
572 |
CreateActorRoleMatrix.tooltip = Create Actor - Role Matrix |
573 |
CreateActorRoleMatrix.image = res/bmp/staticmatrix16.png |
574 |
CreateActorRoleMatrix.group = Traceability Matrices |
575 |
CreateActorRoleMatrix.groupimage = res/bmp/staticmatrix16.png |
576 |
CreateDataEntityBusinessFunctionMatrix.label = DataEntity - BusinessFunction Matrix |
577 |
CreateDataEntityBusinessFunctionMatrix.tooltip = Create DataEntity - BusinessFunction Matrix |
578 |
CreateDataEntityBusinessFunctionMatrix.image = res/bmp/staticmatrix16.png |
579 |
CreateDataEntityBusinessFunctionMatrix.group = Traceability Matrices |
580 |
CreateDataEntityBusinessFunctionMatrix.groupimage = res/bmp/staticmatrix16.png |
581 |
CreateSystemDataMatrix.label = System - Data Matrix |
582 |
CreateSystemDataMatrix.tooltip = Create System - Data Matrix |
583 |
CreateSystemDataMatrix.image = res/bmp/staticmatrix16.png |
584 |
CreateSystemDataMatrix.group = Traceability Matrices |
585 |
CreateSystemDataMatrix.groupimage = res/bmp/staticmatrix16.png |
586 |
CreateSystemOrganizationMatrix.label = System - Organization Matrix |
587 |
CreateSystemOrganizationMatrix.tooltip = Create System - Organization Matrix |
588 |
CreateSystemOrganizationMatrix.image = res/bmp/staticmatrix16.png |
589 |
CreateSystemOrganizationMatrix.group = Traceability Matrices |
590 |
CreateSystemOrganizationMatrix.groupimage = res/bmp/staticmatrix16.png |
591 |
CreateRoleSystemMatrix.label = Role - System Matrix |
592 |
CreateRoleSystemMatrix.tooltip = Create Role - System Matrix |
593 |
CreateRoleSystemMatrix.image = res/bmp/staticmatrix16.png |
594 |
CreateRoleSystemMatrix.group = Traceability Matrices |
595 |
CreateRoleSystemMatrix.groupimage = res/bmp/staticmatrix16.png |
596 |
CreateSystemFunctionMatrix.label = System - Function Matrix |
597 |
CreateSystemFunctionMatrix.tooltip = Create System - Function Matrix |
598 |
CreateSystemFunctionMatrix.image = res/bmp/staticmatrix16.png |
599 |
CreateSystemFunctionMatrix.group = Traceability Matrices |
600 |
CreateSystemFunctionMatrix.groupimage = res/bmp/staticmatrix16.png |
601 |
CreateApplicationInteractionMatrix.label = Application - Interaction Matrix |
602 |
CreateApplicationInteractionMatrix.tooltip = Create Application - Interaction Matrix |
603 |
CreateApplicationInteractionMatrix.image = res/bmp/staticmatrix16.png |
604 |
CreateApplicationInteractionMatrix.group = Traceability Matrices |
605 |
CreateApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png |
606 |
|
607 |
|
608 |
TechnologyArchitectureDomainDiagramCommande.label = Technology Domain |
609 |
TechnologyArchitectureDomainDiagramCommande.tooltip = Technology Domain |
610 |
TechnologyArchitectureDomainDiagramCommande.image = res/bmp/profile/technologydomain16.png |
611 |
DeploymentServerDiagramCommande.label = Server |
612 |
DeploymentServerDiagramCommande.tooltip = Server |
613 |
DeploymentServerDiagramCommande.image = res/bmp/profile/server16.png |
614 |
DeploymentWorkStationDiagramCommande.label = Workstation |
615 |
DeploymentWorkStationDiagramCommande.tooltip = Workstation |
616 |
DeploymentWorkStationDiagramCommande.image = res/bmp/profile/workstation16.png |
617 |
DeploymentInternetDiagramCommande.label = Internet |
618 |
DeploymentInternetDiagramCommande.tooltip = Internet |
619 |
DeploymentInternetDiagramCommande.image = res/bmp/profile/internet16.png |
620 |
DeploymentRouterDiagramCommande.label = Router |
621 |
DeploymentRouterDiagramCommande.tooltip = Router |
622 |
DeploymentRouterDiagramCommande.image = res/bmp/profile/router16.png |
623 |
DeploymentSwitchDiagramCommande.label = Switch |
624 |
DeploymentSwitchDiagramCommande.tooltip = Switch |
625 |
DeploymentSwitchDiagramCommande.image = res/bmp/profile/switch16.png |
626 |
DeploymentNetworkNodeDiagramCommande.label = Network Node |
627 |
DeploymentNetworkNodeDiagramCommande.tooltip = Network Node |
628 |
DeploymentNetworkNodeDiagramCommande.image = res/bmp/profile/networknode16.png |
629 |
BusinessOrganizationDomainDiagramCommande.label = Organization Domain |
630 |
BusinessOrganizationDomainDiagramCommande.tooltip = Organization Domain |
631 |
BusinessOrganizationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png |
632 |
TogafExternalActorDiagramCommande.label = External Actor |
633 |
TogafExternalActorDiagramCommande.tooltip = External Actor |
634 |
TogafExternalActorDiagramCommande.image = res/bmp/profile/externalactor16.png |
635 |
TogafInternalActorDiagramCommande.label = Internal Actor |
636 |
TogafInternalActorDiagramCommande.tooltip = Internal Actor |
637 |
TogafInternalActorDiagramCommande.image = res/bmp/profile/internalactor16.png |
638 |
TogafExternalRoleDiagramCommande.label = External Role |
639 |
TogafExternalRoleDiagramCommande.tooltip = External Role |
640 |
TogafExternalRoleDiagramCommande.image = res/bmp/profile/externalrole16.png |
641 |
TogafInternalRoleDiagramCommande.label = Internal Role |
642 |
TogafInternalRoleDiagramCommande.tooltip = Internal Role |
643 |
TogafInternalRoleDiagramCommande.image = res/bmp/profile/internalrole16.png |
644 |
EventDiagramCommande.label = Event |
645 |
EventDiagramCommande.tooltip = Event |
646 |
EventDiagramCommande.image = res/bmp/profile/event16.png |
647 |
TogafOrganizationUnitDiagramCommande.label = Organization Unit |
648 |
TogafOrganizationUnitDiagramCommande.tooltip = Organization Unit |
649 |
TogafOrganizationUnitDiagramCommande.image = res/bmp/profile/organizationsunit16.png |
650 |
TogafProcessDiagramCommande.label = Business Process |
651 |
TogafProcessDiagramCommande.tooltip = Business Process |
652 |
TogafProcessDiagramCommande.image = res/bmp/profile/togafprocess16.png |
653 |
TogafMacroProcessDiagramCommande.label = Macro Process |
654 |
TogafMacroProcessDiagramCommande.tooltip = Macro Process |
655 |
TogafMacroProcessDiagramCommande.image = res/bmp/profile/macroprocessus16.png |
656 |
TogafBusinessCollaborationDiagramCommande.label = Business Collaboration |
657 |
TogafBusinessCollaborationDiagramCommande.tooltip = Business Collaboration |
658 |
TogafBusinessCollaborationDiagramCommande.image = res/bmp/profile/businesscollaboration16.png |
659 |
TogafFunctionDiagramCommande.label = Function |
660 |
TogafFunctionDiagramCommande.tooltip = Function |
661 |
TogafFunctionDiagramCommande.image = res/bmp/profile/functionservice16.png |
662 |
TogafBusinessServiceDiagramCommande.label = Business Service |
663 |
TogafBusinessServiceDiagramCommande.tooltip = Business Service |
664 |
TogafBusinessServiceDiagramCommande.image = res/bmp/profile/businessservice16.png |
665 |
TogafBusinessCapabilityDiagramCommande.label = Business Capability |
666 |
TogafBusinessCapabilityDiagramCommande.tooltip = Business Capability |
667 |
TogafBusinessCapabilityDiagramCommande.image = res/bmp/profile/businesscapabilityservice16.png |
668 |
TogafBusinessOperationDiagramCommande.label = Operation |
669 |
TogafBusinessOperationDiagramCommande.tooltip = Operation |
670 |
TogafBusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png |
671 |
TogafProductDiagramCommande.label = Product |
672 |
TogafProductDiagramCommande.tooltip = Product |
673 |
TogafProductDiagramCommande.image = res/bmp/profile/togafproduct16.png |
674 |
LocationDiagramCommande.label = Location |
675 |
LocationDiagramCommande.tooltip = Location |
676 |
LocationDiagramCommande.image = res/bmp/profile/location16.png |
677 |
HeadquarterLocationDiagramCommande.label = Headquarter |
678 |
HeadquarterLocationDiagramCommande.tooltip = Headquarter |
679 |
HeadquarterLocationDiagramCommande.image = res/bmp/profile/headquarterlocation16.png |
680 |
TogafServiceContractDiagramCommande.label = Service Contract |
681 |
TogafServiceContractDiagramCommande.tooltip = Service Contract |
682 |
TogafServiceContractDiagramCommande.image = res/bmp/profile/servicecontract16.png |
683 |
SystemApplicationComponentDiagramCommande.label = System |
684 |
SystemApplicationComponentDiagramCommande.tooltip = System |
685 |
SystemApplicationComponentDiagramCommande.image = res/bmp/profile/system16.png |
686 |
TogafSystemFederationDiagramCommande.label = System Federation |
687 |
TogafSystemFederationDiagramCommande.tooltip = System Federation |
688 |
TogafSystemFederationDiagramCommande.image = res/bmp/profile/systemfederation16.png |
689 |
TogafEnterpriseSystemDiagramCommande.label = Enterprise System |
690 |
TogafEnterpriseSystemDiagramCommande.tooltip = Enterprise System |
691 |
TogafEnterpriseSystemDiagramCommande.image = res/bmp/profile/enterprisesystem16.png |
692 |
TogafApplicationDiagramCommande.label = Application |
693 |
TogafApplicationDiagramCommande.tooltip = Application |
694 |
TogafApplicationDiagramCommande.image = res/bmp/profile/application16.png |
695 |
ServiceApplicationComponentDiagramCommande.label = Service Component |
696 |
ServiceApplicationComponentDiagramCommande.tooltip = Service Component |
697 |
ServiceApplicationComponentDiagramCommande.image = res/bmp/profile/applicationcomponent16.png |
698 |
InteractionApplicationComponentDiagramCommande.label = Interaction Component |
699 |
InteractionApplicationComponentDiagramCommande.tooltip = Interaction Component |
700 |
InteractionApplicationComponentDiagramCommande.image = res/bmp/profile/interactioncomponent16.png |
701 |
ProcessApplicationComponentDiagramCommande.label = Process Component |
702 |
ProcessApplicationComponentDiagramCommande.tooltip = Process Component |
703 |
ProcessApplicationComponentDiagramCommande.image = res/bmp/profile/processcomponent16.png |
704 |
IntermediaryApplicationComponentDiagramCommande.label = Intermediary Component |
705 |
IntermediaryApplicationComponentDiagramCommande.tooltip = Intermediary Component |
706 |
IntermediaryApplicationComponentDiagramCommande.image = res/bmp/profile/intermediarycomponent16.png |
707 |
PublicApplicationComponentDiagramCommande.label = Public Component |
708 |
PublicApplicationComponentDiagramCommande.tooltip = Public Component |
709 |
PublicApplicationComponentDiagramCommande.image = res/bmp/profile/publiccomponent16.png |
710 |
UtilityApplicationComponentDiagramCommande.label = Utility Component |
711 |
UtilityApplicationComponentDiagramCommande.tooltip = Utility Component |
712 |
UtilityApplicationComponentDiagramCommande.image = res/bmp/profile/utilitycomponent16.png |
713 |
EntityApplicationComponentDiagramCommande.label = Entity Component |
714 |
EntityApplicationComponentDiagramCommande.tooltip = Entity Component |
715 |
EntityApplicationComponentDiagramCommande.image = res/bmp/profile/entitycomponent16.png |
716 |
DataBaseApplicationComponentDiagramCommande.label = Database |
717 |
DataBaseApplicationComponentDiagramCommande.tooltip = Database |
718 |
DataBaseApplicationComponentDiagramCommande.image = res/bmp/profile/databaseapplicationcomponent16.png |
719 |
TogafApplicationCollaborationDiagramCommande.label = Application Collaboration |
720 |
TogafApplicationCollaborationDiagramCommande.tooltip = Application Collaboration |
721 |
TogafApplicationCollaborationDiagramCommande.image = res/bmp/profile/applicationcollaboration16.png |
722 |
ProvidedServiceAccessDiagramCommande.label = Provided |
723 |
ProvidedServiceAccessDiagramCommande.tooltip = Provided |
724 |
ProvidedServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessprovide16.png |
725 |
RequiredServiceAccessDiagramCommande.label = Required |
726 |
RequiredServiceAccessDiagramCommande.tooltip = Required |
727 |
RequiredServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessrequired16.png |
728 |
TogafISServiceDiagramCommande.label = IS Service |
729 |
TogafISServiceDiagramCommande.tooltip = IS Service |
730 |
TogafISServiceDiagramCommande.image = res/bmp/profile/isservice16.png |
731 |
TogafISServiceOperationDiagramCommande.label = IS Service Operation |
732 |
TogafISServiceOperationDiagramCommande.tooltip = IS Service Operation |
733 |
TogafISServiceOperationDiagramCommande.image = res/bmp/profile/isserviceoperation16.png |
734 |
ApplicationComponentOperationDiagramCommande.label = Application Operation |
735 |
ApplicationComponentOperationDiagramCommande.tooltip = Application Operation |
736 |
ApplicationComponentOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png |
737 |
TogafApplicationComponentInstanceDiagramCommande.label = Application Instance |
738 |
TogafApplicationComponentInstanceDiagramCommande.tooltip = Application Instance |
739 |
TogafApplicationComponentInstanceDiagramCommande.image = res/bmp/profile/applicationcomponentinstance16.png |
740 |
MessageDiagramCommande.label = Message |
741 |
MessageDiagramCommande.tooltip = Message |
742 |
MessageDiagramCommande.image = res/bmp/profile/servicedata16.png |
743 |
ServiceDataFragmentDiagramCommande.label = Message Fragment |
744 |
ServiceDataFragmentDiagramCommande.tooltip = Message Fragment |
745 |
ServiceDataFragmentDiagramCommande.image = res/bmp/profile/servicedatafragment16.png |
746 |
ApplicationArchitectureAttributeDiagramCommande.label = Application Attribute |
747 |
ApplicationArchitectureAttributeDiagramCommande.tooltip = Application Attribute |
748 |
ApplicationArchitectureAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png |
749 |
InformationDomainDiagramCommande.label = Information Domain |
750 |
InformationDomainDiagramCommande.tooltip = Information Domain |
751 |
InformationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png |
752 |
BusinessEntityDiagramCommande.label = Business Entity |
753 |
BusinessEntityDiagramCommande.tooltip = Business Entity |
754 |
BusinessEntityDiagramCommande.image = res/bmp/profile/businessentitys16.png |
755 |
BusinessOperationDiagramCommande.label = Operation |
756 |
BusinessOperationDiagramCommande.tooltip = Operation |
757 |
BusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png |
758 |
BusinessAttributeDiagramCommande.label = Attribute |
759 |
BusinessAttributeDiagramCommande.tooltip = Attribute |
760 |
BusinessAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png |
761 |
TogafEnumerationDiagramCommande.label = Enumeration |
762 |
TogafEnumerationDiagramCommande.tooltip = Enumeration |
763 |
TogafEnumerationDiagramCommande.image = res/bmp/profile/businessenumeration16.png |
764 |
UMLEnumerationLitteralDiagramCommande.label = Enumeration Literal |
765 |
UMLEnumerationLitteralDiagramCommande.tooltip = Enumeration Literal |
766 |
UMLEnumerationLitteralDiagramCommande.image = res/bmp/modelio/umlenumerationlitteral.png |
767 |
BusinessDataTypeDiagramCommande.label = Business Data Type |
768 |
BusinessDataTypeDiagramCommande.tooltip = Business Data Type |
769 |
BusinessDataTypeDiagramCommande.image = res/bmp/profile/businessdatatype16.png |
770 |
UMLPortDiagramCommande.label = Port |
771 |
UMLPortDiagramCommande.tooltip = Port |
772 |
UMLPortDiagramCommande.image = res/bmp/modelio/umlport.png |
773 |
TogafBusDiagramCommande.label = Bus |
774 |
TogafBusDiagramCommande.tooltip = Bus |
775 |
TogafBusDiagramCommande.image = res/bmp/profile/togafbus16.png |
776 |
ConnexionDiagramCommande.label = Connection |
777 |
ConnexionDiagramCommande.tooltip = Hardware Tecnology Component/Instance -> Hardware Tecnology Component/Instance |
778 |
ConnexionDiagramCommande.image = res/bmp/profile/connexion16.png |
779 |
NetworkLinkDiagramCommande.label = Network Link |
780 |
NetworkLinkDiagramCommande.tooltip = Network Link : Technology Architecture Element/Technology Architecture Element |
781 |
NetworkLinkDiagramCommande.image = res/bmp/profile/togafnetworklink16.png |
782 |
TogafFunctionSequenceDiagramCommande.label = Sequence |
783 |
TogafFunctionSequenceDiagramCommande.tooltip = Function -> Function |
784 |
TogafFunctionSequenceDiagramCommande.image = res/bmp/profile/togaffunctionsequence16.png |
785 |
IOFlowDiagramCommande.label = Flow |
786 |
IOFlowDiagramCommande.tooltip = Any active element<-->Product/Entity/Event |
787 |
IOFlowDiagramCommande.image = res/bmp/profile/ioflow16.png |
788 |
AssumesDiagramCommande.label = Assumes |
789 |
AssumesDiagramCommande.tooltip = Actor -> Role |
790 |
AssumesDiagramCommande.image = res/bmp/profile/assumes16.png |
791 |
TogafConsumesDiagramCommande.label = Consumes |
792 |
TogafConsumesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Operation/Service/Component |
793 |
TogafConsumesDiagramCommande.image = res/bmp/profile/togafconsumes16.png |
794 |
InitiatorDiagramCommande.label = Initiator of |
795 |
InitiatorDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process |
796 |
InitiatorDiagramCommande.image = res/bmp/profile/initiator16.png |
797 |
ResponsibleDiagramCommande.label = Responsible of |
798 |
ResponsibleDiagramCommande.tooltip = Role/Actor -> Role/Actor/Organization Unit |
799 |
ResponsibleDiagramCommande.image = res/bmp/profile/responsible16.png |
800 |
ParticipatesDiagramCommande.label = Participates in |
801 |
ParticipatesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service/Service Operation |
802 |
ParticipatesDiagramCommande.image = res/bmp/profile/participates16.png |
803 |
CommunicatesDiagramCommande.label = Communicates with |
804 |
CommunicatesDiagramCommande.tooltip = Role/Actor -> Role/Actor |
805 |
CommunicatesDiagramCommande.image = res/bmp/profile/communicates16.png |
806 |
OwnerDiagramCommande.label = Owner of |
807 |
OwnerDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service |
808 |
OwnerDiagramCommande.image = res/bmp/profile/owner16.png |
809 |
ContractOfDiagramCommand.label = Contract of |
810 |
ContractOfDiagramCommand.tooltip = Service -> Service Contract |
811 |
ContractOfDiagramCommand.image = res/bmp/profile/contractof16.png |
812 |
TogafParticipantDecomposition.label = Composed of |
813 |
TogafParticipantDecomposition.tooltip = Role/Actor -> Role/Actor |
814 |
TogafParticipantDecomposition.image = res/bmp/profile/participantdecomposition16.png |
815 |
ServiceProcessSupportDiagramCommande.label = Supports |
816 |
ServiceProcessSupportDiagramCommande.tooltip = Service/Service Access/Process/Component -> Service/Process |
817 |
ServiceProcessSupportDiagramCommande.image = res/bmp/profile/serviceprocesssupport16.png |
818 |
PartDiagramCommande.label = Part |
819 |
PartDiagramCommande.tooltip = Function <--> Function |
820 |
PartDiagramCommande.image = res/bmp/profile/part16.png |
821 |
TogafLocalizationDiagramCommande.label = Localization |
822 |
TogafLocalizationDiagramCommande.tooltip = Role/Actor/Organization Unit -> Location |
823 |
TogafLocalizationDiagramCommande.image = res/bmp/profile/togaflocalization16.png |
824 |
TogafParticipantAllocationDiagramCommande.label = Allocated |
825 |
TogafParticipantAllocationDiagramCommande.tooltip = Role/Actor -> Organization Unit |
826 |
TogafParticipantAllocationDiagramCommande.image = res/bmp/profile/togafparticipantallocation16.png |
827 |
ComponentRealizationDiagramCommande.label = Component Realization |
828 |
ComponentRealizationDiagramCommande.tooltip = Component -> Service/Process/Use Case |
829 |
ComponentRealizationDiagramCommande.image = res/bmp/profile/componentrealizationinitiator16.png |
830 |
MigrationDiagramCommand.label = Migrate |
831 |
MigrationDiagramCommand.tooltip = Migrate |
832 |
MigrationDiagramCommand.image = res/bmp/profile/migration.png |
833 |
UMLInformationFLowDiagramCommand.label = Information Flow |
834 |
UMLInformationFLowDiagramCommand.tooltip = Information Flow |
835 |
UMLInformationFLowDiagramCommand.image = res/bmp/modelio/umlinformationflow.png |
836 |
|
837 |
|
838 |
|
839 |
TogafClassDiagramWizardContributor.label = Class diagram |
840 |
TogafClassDiagramWizardContributor.icon = res/bmp/profile/classdiagram16.png |
841 |
TogafClassDiagramWizardContributor.info = Class diagram |
842 |
TogafClassDiagramWizardContributor.detail = The key purpose of the Class diagram is to depict the relationships among the critical data entities (or classes) within the enterprise. |
843 |
TogafClassDiagramWizardContributor.preview = res/bmp/profile/classdiagrampreview.png |
844 |
TogafClassHierachyDiagramWizardContributor.label = Class Hierarchy diagram |
845 |
TogafClassHierachyDiagramWizardContributor.icon = res/bmp/profile/classhierachydiagram16.png |
846 |
TogafClassHierachyDiagramWizardContributor.info = Class Hierarchy diagram |
847 |
TogafClassHierachyDiagramWizardContributor.detail = The purpose of the Class Hierarchy diagram is to show the technical stakeholders a perspective of the class hierarchy. |
848 |
TogafClassHierachyDiagramWizardContributor.preview = res/bmp/profile/classhierachydiagrampreview.png |
849 |
TogafDataLifeCycleDiagramWizardContributor.label = Data Lifecycle diagram |
850 |
TogafDataLifeCycleDiagramWizardContributor.icon = res/bmp/profile/togafdatalifecyclediagram16.png |
851 |
TogafDataLifeCycleDiagramWizardContributor.info = Data Lifecycle diagram |
852 |
TogafDataLifeCycleDiagramWizardContributor.detail = The Entity Lifecycle diagram is an essential part of managing business entities throughout its lifecycle from conception until disposal within the constraints of the business process. |
853 |
TogafDataLifeCycleDiagramWizardContributor.preview = res/bmp/profile/togafdatalifecyclediagrampreview.png |
854 |
TogafApplicationAndUserLocationDiagramWizardContributor.label = Application and User Location diagram |
855 |
TogafApplicationAndUserLocationDiagramWizardContributor.icon = res/bmp/profile/togafapplicationanduserlocationdiagram16.png |
856 |
TogafApplicationAndUserLocationDiagramWizardContributor.info = Application and User Location diagram |
857 |
TogafApplicationAndUserLocationDiagramWizardContributor.detail = The application and user location diagram shows the geographical distribution of applications. |
858 |
TogafApplicationAndUserLocationDiagramWizardContributor.preview = res/bmp/profile/togafapplicationanduserlocationdiagrampreview.png |
859 |
TogafDataMigrationDiagramWizardContributor.label = Data Migration diagram |
860 |
TogafDataMigrationDiagramWizardContributor.icon = res/bmp/profile/datamigrationdiagram16.png |
861 |
TogafDataMigrationDiagramWizardContributor.info = Data Migration diagram |
862 |
TogafDataMigrationDiagramWizardContributor.detail = The purpose of the Data Migration diagram is to show the flow of data from the source to the target applications. |
863 |
TogafDataMigrationDiagramWizardContributor.preview = res/bmp/profile/datamigrationdiagrampreview.png |
864 |
TogafBusinessFootPrintDiagramWizardContributor.label = Business Footprint diagram |
865 |
TogafBusinessFootPrintDiagramWizardContributor.icon = res/bmp/profile/businessfootprintdiagram16.png |
866 |
TogafBusinessFootPrintDiagramWizardContributor.info = Business Footprint diagram |
867 |
TogafBusinessFootPrintDiagramWizardContributor.detail = A Business Footprint diagram describes the links between business goals, organizational units, business functions, and services, and maps these functions to the technical components delivering the required capability. |
868 |
TogafBusinessFootPrintDiagramWizardContributor.preview = res/bmp/profile/businessfootprintdiagrampreview.png |
869 |
TogafApplicationCommunicationDiagramWizardContributor.label = Application Communication diagram |
870 |
TogafApplicationCommunicationDiagramWizardContributor.icon = res/bmp/profile/applicationcommunicationdiagram16.png |
871 |
TogafApplicationCommunicationDiagramWizardContributor.info = Application Communication diagram |
872 |
TogafApplicationCommunicationDiagramWizardContributor.detail = The purpose of the Application Communication diagram is to depict all models and mappings related to communication between applications in the metamodel entity. |
873 |
TogafApplicationCommunicationDiagramWizardContributor.preview = res/bmp/profile/applicationcommunicationdiagrampreview.png |
874 |
TogafSystemUseCaseDiagramWizardContributor.label = System Use Case diagram |
875 |
TogafSystemUseCaseDiagramWizardContributor.icon = res/bmp/profile/togafsystemusecasediagram16.png |
876 |
TogafSystemUseCaseDiagramWizardContributor.info = System Use Case diagram |
877 |
TogafSystemUseCaseDiagramWizardContributor.detail = A Use-Case diagram displays the relationships between consumers and providers of Services. |
878 |
TogafSystemUseCaseDiagramWizardContributor.preview = res/bmp/profile/togafsystemusecasediagrampreview.png |
879 |
TogafApplicationMigrationDiagramWizardContributor.label = Application Migration diagram |
880 |
TogafApplicationMigrationDiagramWizardContributor.icon = res/bmp/profile/togafapplicationmigrationdiagram16.png |
881 |
TogafApplicationMigrationDiagramWizardContributor.info = Application Migration diagram |
882 |
TogafApplicationMigrationDiagramWizardContributor.detail = The Application Migration diagram identifies application migration from baseline to target application components. |
883 |
TogafApplicationMigrationDiagramWizardContributor.preview = res/bmp/profile/togafapplicationmigrationdiagrampreview.png |
884 |
TogafDataDisseminationDiagramWizardContributor.label = Data Dissemination diagram |
885 |
TogafDataDisseminationDiagramWizardContributor.icon = res/bmp/profile/togafdatadisseminationdiagram16.png |
886 |
TogafDataDisseminationDiagramWizardContributor.info = Data Dissemination diagram |
887 |
TogafDataDisseminationDiagramWizardContributor.detail = The purpose of the Data Dissemination diagram is to show the relationship between data entities, business services, and application components. |
888 |
TogafDataDisseminationDiagramWizardContributor.preview = res/bmp/profile/togafdatadisseminationdiagrampreview.png |
889 |
TogafEnterpriseManageabilityDiagramWizardContributor.label = Enterprise Manageability diagram |
890 |
TogafEnterpriseManageabilityDiagramWizardContributor.icon = res/bmp/profile/togafenterprisemanageabilitydiagram16.png |
891 |
TogafEnterpriseManageabilityDiagramWizardContributor.info = Enterprise Manageability diagram |
892 |
TogafEnterpriseManageabilityDiagramWizardContributor.detail = The Enterprise Manageability diagram shows how one or more applications interact with application and technology components that support operational management of a solution. |
893 |
TogafEnterpriseManageabilityDiagramWizardContributor.preview = res/bmp/profile/togafenterprisemanageabilitydiagrampreview.png |
894 |
TogafProcessSystemRealizationDiagramWizardContributor.label = Process System Realization diagram |
895 |
TogafProcessSystemRealizationDiagramWizardContributor.icon = res/bmp/profile/togafprocesssystemrealizationdiagram16.png |
896 |
TogafProcessSystemRealizationDiagramWizardContributor.info = Process System Realization diagram |
897 |
TogafProcessSystemRealizationDiagramWizardContributor.detail = The purpose of the Process/System Realization diagram is to clearly depict the sequence of events when multiple applications are involved in executing a business process. |
898 |
TogafProcessSystemRealizationDiagramWizardContributor.preview = res/bmp/profile/togafprocesssystemrealizationdiagrampreview.png |
899 |
TogafProjectContextDiagramWizardContributor.label = Project Context diagram |
900 |
TogafProjectContextDiagramWizardContributor.icon = res/bmp/profile/togafprojectcontextdiagram16.png |
901 |
TogafProjectContextDiagramWizardContributor.info = Project Context diagram |
902 |
TogafProjectContextDiagramWizardContributor.detail = A Project Context diagram shows the scope of a work package to be implemented as a part of a broader transformation roadmap. |
903 |
TogafProjectContextDiagramWizardContributor.preview = res/bmp/profile/togafprojectcontextdiagrampreview.png |
904 |
TogafSolutionConceptDiagramWizardContributor.label = Solution Concept diagram |
905 |
TogafSolutionConceptDiagramWizardContributor.icon = res/bmp/profile/togafsolutionconceptdiagram16.png |
906 |
TogafSolutionConceptDiagramWizardContributor.info = Solution Concept diagram |
907 |
TogafSolutionConceptDiagramWizardContributor.detail = A Solution Concept diagram provides a high-level orientation of the solution that is envisaged in order to meet the objectives of the architecture engagement. |
908 |
TogafSolutionConceptDiagramWizardContributor.preview = res/bmp/profile/togafsolutionconceptdiagrampreview.png |
909 |
TogafBenefitsDiagramWizardContributor.label = Benefits diagram |
910 |
TogafBenefitsDiagramWizardContributor.icon = res/bmp/profile/togafbenefitsdiagram16.png |
911 |
TogafBenefitsDiagramWizardContributor.info = Benefits diagram |
912 |
TogafBenefitsDiagramWizardContributor.detail = The Benefits diagram shows opportunities identified in an architecture definition, classified according to their relative size, benefit, and complexity. |
913 |
TogafBenefitsDiagramWizardContributor.preview = res/bmp/profile/togafbenefitsdiagrampreview.png |
914 |
TogafBusinessServiceInformationDiagramWizardContributor.label = Business Service Information diagram |
915 |
TogafBusinessServiceInformationDiagramWizardContributor.icon = res/bmp/profile/businessserviceinformationdiagram16.png |
916 |
TogafBusinessServiceInformationDiagramWizardContributor.info = Business Service Information diagram |
917 |
TogafBusinessServiceInformationDiagramWizardContributor.detail = The Business Service/Information diagram shows the information needed to support one or more business services. |
918 |
TogafBusinessServiceInformationDiagramWizardContributor.preview = res/bmp/profile/businessserviceinformationdiagrampreview.png |
919 |
TogafUseCaseDiagramWizardContributor.label = Use Case diagram |
920 |
TogafUseCaseDiagramWizardContributor.icon = res/bmp/profile/togafusecasediagram16.png |
921 |
TogafUseCaseDiagramWizardContributor.info = Use Case diagram |
922 |
TogafUseCaseDiagramWizardContributor.detail = A Use-Case diagram displays the relationships between consumers and providers of Services. |
923 |
TogafUseCaseDiagramWizardContributor.preview = res/bmp/profile/togafusecasediagrampreview.png |
924 |
ServiceDataDiagramWizardContributor.label = Logical Data diagram |
925 |
ServiceDataDiagramWizardContributor.icon = res/bmp/profile/servicedatadiagram16.png |
926 |
ServiceDataDiagramWizardContributor.info = Logical Data diagram |
927 |
ServiceDataDiagramWizardContributor.detail = Messages need a dedicated model and definition. |
928 |
ServiceDataDiagramWizardContributor.preview = res/bmp/profile/servicedatadiagrampreview.png |
929 |
SoftwareEngineeringDiagramWizardContributor.label = Software Engineering diagram |
930 |
SoftwareEngineeringDiagramWizardContributor.icon = res/bmp/modelio/softwareengineering16.png |
931 |
SoftwareEngineeringDiagramWizardContributor.info = Software Engineering diagram |
932 |
SoftwareEngineeringDiagramWizardContributor.detail = The purpose of Software Engineering diagrams is to define TOGAF Software Engineering |
933 |
SoftwareDistributionDiagramWizardContributor.label = Software Distribution diagram |
934 |
SoftwareDistributionDiagramWizardContributor.icon = res/bmp/modelio/softwaredistribution16.png |
935 |
SoftwareDistributionDiagramWizardContributor.info = Software Distribution diagram |
936 |
SoftwareDistributionDiagramWizardContributor.detail = The Software Distribution diagram shows how application software is structured and distributed across the estate. |
937 |
SoftwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png |
938 |
TogafProcessFlowDiagramWizardContributor.label = Process Flow diagram |
939 |
TogafProcessFlowDiagramWizardContributor.icon = res/bmp/profile/processflowdiagram16.png |
940 |
TogafProcessFlowDiagramWizardContributor.info = Process Flow diagram |
941 |
TogafProcessFlowDiagramWizardContributor.detail = Business Process modeling is done using business process diagrams.\nThe purpose of the business process diagram is to depict all models and mappings related to a process. |
942 |
TogafProcessFlowDiagramWizardContributor.preview = res/bmp/profile/processflowdiagrampreview.png |
943 |
TogafFunctionalDecompositionDiagramWizardContributor.label = Functional Decomposition diagram |
944 |
TogafFunctionalDecompositionDiagramWizardContributor.icon = res/bmp/profile/functionaldecompositiondiagram16.png |
945 |
TogafFunctionalDecompositionDiagramWizardContributor.info = Togaf Functional Decomposition diagram |
946 |
TogafFunctionalDecompositionDiagramWizardContributor.detail = The purpose of the Functional Decomposition diagram is to show on a single page the capabilities of an organization that are relevant to the consideration of an architecture. |
947 |
TogafFunctionalDecompositionDiagramWizardContributor.preview = res/bmp/profile/functionaldecompositiondiagrampreview.png |
948 |
TogafProductLifeCycleDiagramWizardContributor.label = Product Lifecycle diagram |
949 |
TogafProductLifeCycleDiagramWizardContributor.icon = res/bmp/profile/productlifecyclediagram16.png |
950 |
TogafProductLifeCycleDiagramWizardContributor.info = Product Lifecycle diagram |
951 |
TogafProductLifeCycleDiagramWizardContributor.detail = The purpose of the Product Lifecycle diagram is to assist in understanding the lifecycles of key entities within the enterprise. |
952 |
TogafProductLifeCycleDiagramWizardContributor.preview = res/bmp/profile/productlifecyclediagrampreview.png |
953 |
TogafGoalObjectiveServiceDiagramWizardContributor.label = Driver/Goal/Objectives diagram |
954 |
TogafGoalObjectiveServiceDiagramWizardContributor.icon = res/bmp/profile/goalobjectiveservicediagram16.png |
955 |
TogafGoalObjectiveServiceDiagramWizardContributor.info = Driver/Goal/Objectives diagram |
956 |
TogafGoalObjectiveServiceDiagramWizardContributor.detail = The purpose of a Goal/Objective/Service diagram is to define the ways in which a service contributes to the achievement of a business vision or strategy. |
957 |
TogafGoalObjectiveServiceDiagramWizardContributor.preview = res/bmp/profile/goalobjectiveservicediagrampreview.png |
958 |
TogafBusinessUseCaseDiagramWizardContributor.label = Business Use Case diagram |
959 |
TogafBusinessUseCaseDiagramWizardContributor.icon = res/bmp/profile/togafusecasediagram16.png |
960 |
TogafBusinessUseCaseDiagramWizardContributor.info = Business Use Case diagram |
961 |
TogafBusinessUseCaseDiagramWizardContributor.detail = A Business Use-Case diagram displays the relationships between consumers and providers of business services. |
962 |
TogafBusinessUseCaseDiagramWizardContributor.preview = res/bmp/profile/togafusecasediagrampreview.png |
963 |
TogafOrganizationRoleDiagramWizardContributor.label = Organization Role diagram |
964 |
TogafOrganizationRoleDiagramWizardContributor.icon = res/bmp/profile/organizationrolediagram16.png |
965 |
TogafOrganizationRoleDiagramWizardContributor.info = Organization Role diagram |
966 |
TogafOrganizationRoleDiagramWizardContributor.detail = Diagram dedicated to the definition of participants and their responsibilities. Roles and actors are modeled here. |
967 |
TogafOrganizationRoleDiagramWizardContributor.preview = res/bmp/profile/organizationrolediagrampreview.png |
968 |
TogafOrganizationDecompositionDiagramWizardContributor.label = Organization Decomposition diagram |
969 |
TogafOrganizationDecompositionDiagramWizardContributor.icon = res/bmp/profile/organizationdecompositiondiagram16.png |
970 |
TogafOrganizationDecompositionDiagramWizardContributor.info = Organization Decomposition diagram |
971 |
TogafOrganizationDecompositionDiagramWizardContributor.detail = An Organization diagram describes the links between actors, and locations within an organization tree. |
972 |
TogafOrganizationDecompositionDiagramWizardContributor.preview = res/bmp/profile/organizationdecompositiondiagrampreview.png |
973 |
TogafEventDiagramWizardContributor.label = Event diagram |
974 |
TogafEventDiagramWizardContributor.icon = res/bmp/profile/togafeventdiagram16.png |
975 |
TogafEventDiagramWizardContributor.info = Event diagram |
976 |
TogafEventDiagramWizardContributor.detail = The purpose of the process map diagram is to depict the relationship between events and process, and to show an overview of the business processes. |
977 |
TogafEventDiagramWizardContributor.preview = res/bmp/profile/togafeventdiagrampreview.png |
978 |
TogafDataSecurityDiagramWizardContributor.label = Data Security diagram |
979 |
TogafDataSecurityDiagramWizardContributor.icon = res/bmp/profile/togafdatasecuritydiagram16.png |
980 |
TogafDataSecurityDiagramWizardContributor.info = Data Security diagram |
981 |
TogafDataSecurityDiagramWizardContributor.detail = Data is considered as an asset to the enterprise and data security simply means ensuring that enterprise data is not compromised and that access to it is suitably controlled. |
982 |
TogafDataSecurityDiagramWizardContributor.preview = res/bmp/profile/togafdatasecuritydiagrampreview.png |
983 |
TogafValueChainDiagramWizardContributor.label = Value Chain diagram |
984 |
TogafValueChainDiagramWizardContributor.icon = res/bmp/profile/togafvaluechaindiagram16.png |
985 |
TogafValueChainDiagramWizardContributor.info = Value Chain diagram |
986 |
TogafValueChainDiagramWizardContributor.detail = A Value Chain diagram provides a high-level orientation view of an enterprise and how it interacts with the outside world. |
987 |
TogafValueChainDiagramWizardContributor.preview = res/bmp/profile/togafvaluechaindiagrampreview.png |
988 |
TogafLocationDiagramWizardContributor.label = Location diagram |
989 |
TogafLocationDiagramWizardContributor.icon = res/bmp/profile/togaflocationdiagram16.png |
990 |
TogafLocationDiagramWizardContributor.info = Location diagram |
991 |
TogafLocationDiagramWizardContributor.detail = This kind of diagram helps in formalizing the locations of an enterprise, and the distribution of platforms and business services on it. |
992 |
TogafLocationDiagramWizardContributor.preview = res/bmp/profile/togaflocationdiagrampreview.png |
993 |
TogafEnvironmentAndLocationsDiagramWizardContributor.label = Environment and Locations diagram |
994 |
TogafEnvironmentAndLocationsDiagramWizardContributor.icon = res/bmp/profile/togafenvironmentandlocationsdiagram16.png |
995 |
TogafEnvironmentAndLocationsDiagramWizardContributor.info = Environment and Locations diagram |
996 |
TogafEnvironmentAndLocationsDiagramWizardContributor.detail = Environments and Locations diagram depicts which locations host which applications, identifies what technologies and/or applications are used at which locations, and finally identifies the locations from which business users typically interact with the applications. |
997 |
TogafEnvironmentAndLocationsDiagramWizardContributor.preview = res/bmp/profile/togafenvironmentandlocationsdiagrampreview.png |
998 |
TogafNewtorkComputingHardwareDiagramWizardContributor.label = Network Computing Hardware diagram |
999 |
TogafNewtorkComputingHardwareDiagramWizardContributor.icon = res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png |
1000 |
TogafNewtorkComputingHardwareDiagramWizardContributor.info = Network Computing Hardware diagram |
1001 |
TogafNewtorkComputingHardwareDiagramWizardContributor.detail = Representation of the deployment of service components to computing devices (i.e. servers, workstations, \u2026). |
1002 |
TogafNewtorkComputingHardwareDiagramWizardContributor.preview = res/bmp/profile/togafnewtorkcomputinghardwarediagrampreview.png |
1003 |
TogafPlatformDecompositionDiagramWizardContributor.label = Platform decomposition diagram |
1004 |
TogafPlatformDecompositionDiagramWizardContributor.icon = res/bmp/profile/togafplatformdecompositiondiagram16.png |
1005 |
TogafPlatformDecompositionDiagramWizardContributor.info = Platform Decomposition diagram |
1006 |
TogafPlatformDecompositionDiagramWizardContributor.detail = The Platform Decomposition diagram depicts the technology platform that supports the operations of the Information Systems Architecture. |
1007 |
TogafPlatformDecompositionDiagramWizardContributor.preview = res/bmp/profile/togafplatformdecompositiondiagrampreview.png |
1008 |
TogafProcessingDiagramWizardContributor.label = Processing diagram |
1009 |
TogafProcessingDiagramWizardContributor.icon = res/bmp/profile/togafprocessingdiagram16.png |
1010 |
TogafProcessingDiagramWizardContributor.info = Processing diagram |
1011 |
TogafProcessingDiagramWizardContributor.detail = The Software Distribution diagram shows how application software is structured and distributed across the estate. |
1012 |
TogafProcessingDiagramWizardContributor.preview = res/bmp/profile/togafprocessingdiagrampreview.png |
1013 |
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram |
1014 |
TogafCommunicationEngineeringDiagramsCommande.icon = res/bmp/profile/togafcommunicationengineeringdiagrams16.png |
1015 |
TogafCommunicationEngineeringDiagramsCommande.info = Communication Engineering diagram |
1016 |
TogafCommunicationEngineeringDiagramsCommande.detail = The Communications Engineering diagram describes the means of communication, the method of sending and receiving information between these assets in the Technology Architecture; insofar as the selection of package solutions in the preceding architectures put specific requirements on the communications between the applications. |
1017 |
TogafCommunicationEngineeringDiagramsCommande.preview = res/bmp/profile/togafcommunicationengineeringdiagramspreview.png |
1018 |
TogafSofwareDistributionDiagramWizardContributor.label = Software Distribution diagram |
1019 |
TogafSofwareDistributionDiagramWizardContributor.icon = res/bmp/profile/sofwaredistributiondiagram16.png |
1020 |
TogafSofwareDistributionDiagramWizardContributor.info = Software Distribution diagram |
1021 |
TogafSofwareDistributionDiagramWizardContributor.detail = The Software Distribution diagram shows how application software is structured and distributed across the estate. |
1022 |
TogafSofwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png |
1023 |
TogafMatrixDiagramWizardContributor.label = Traceability diagram |
1024 |
TogafMatrixDiagramWizardContributor.icon = res/bmp/profile/togafmatrixdiagram16.png |
1025 |
TogafMatrixDiagramWizardContributor.info = Traceability diagram |
1026 |
TogafMatrixDiagramWizardContributor.detail = The purpose of Matrix diagrams is to define dependencies that will produce the Excell Matrices. Matrix diagrams are also useful to define general purpose traceabilities between elements. |
1027 |
TogafMatrixDiagramWizardContributor.preview = res/bmp/profile/togafmatrixdiagrampreview.png |
1028 |
|
1029 |
|
1030 |
TogafClassDiagramCommand.label = Class diagram |
1031 |
TogafClassDiagramCommand.tooltip = Class diagram |
1032 |
TogafClassDiagramCommand.image = res/bmp/profile/classdiagram16.png |
1033 |
TogafClassHierachyDiagramCommand.label = Class Hierarchy diagram |
1034 |
TogafClassHierachyDiagramCommand.tooltip = Class Hierarchy diagram |
1035 |
TogafClassHierachyDiagramCommand.image = res/bmp/profile/classhierachydiagram16.png |
1036 |
TogafDataLifeCycleDiagramCommand.label = Data Lifecycle diagram |
1037 |
TogafDataLifeCycleDiagramCommand.tooltip = Data Lifecycle diagram |
1038 |
TogafDataLifeCycleDiagramCommand.image = res/bmp/profile/togafdatalifecyclediagram16.png |
1039 |
TogafApplicationAndUserLocationDiagramCommande.label = Application and User Location diagram |
1040 |
TogafApplicationAndUserLocationDiagramCommande.tooltip = Application and User Location diagram |
1041 |
TogafApplicationAndUserLocationDiagramCommande.image = res/bmp/profile/togafapplicationanduserlocationdiagram16.png |
1042 |
TogafDataMigrationDiagramCommand.label = Data Migration diagram |
1043 |
TogafDataMigrationDiagramCommand.tooltip = Data Migration diagram |
1044 |
TogafDataMigrationDiagramCommand.image = res/bmp/profile/datamigrationdiagram16.png |
1045 |
TogafBusinessFootPrintDiagramCommande.label = Business Footprint diagram |
1046 |
TogafBusinessFootPrintDiagramCommande.tooltip = Business Footprint diagram |
1047 |
TogafBusinessFootPrintDiagramCommande.image = res/bmp/profile/businessfootprintdiagram16.png |
1048 |
TogafApplicationCommunicationDiagramCommande.label = Application Communication diagram |
1049 |
TogafApplicationCommunicationDiagramCommande.tooltip = Application Communication diagram |
1050 |
TogafApplicationCommunicationDiagramCommande.image = res/bmp/profile/applicationcommunicationdiagram16.png |
1051 |
TogafSystemUseCaseDiagramCommande.label = System Use Case diagram |
1052 |
TogafSystemUseCaseDiagramCommande.tooltip = System Use Case diagram |
1053 |
TogafSystemUseCaseDiagramCommande.image = res/bmp/profile/togafsystemusecasediagram16.png |
1054 |
TogafApplicationMigrationDiagramCommande.label = Application Migration diagram |
1055 |
TogafApplicationMigrationDiagramCommande.tooltip = Application Migration diagram |
1056 |
TogafApplicationMigrationDiagramCommande.image = res/bmp/profile/togafapplicationmigrationdiagram16.png |
1057 |
TogafDataDisseminationDiagramCommande.label = Data Dissemination diagram |
1058 |
TogafDataDisseminationDiagramCommande.tooltip = Data Dissemination diagram |
1059 |
TogafDataDisseminationDiagramCommande.image = res/bmp/profile/togafdatadisseminationdiagram16.png |
1060 |
TogafEnterpriseManageabilityDiagramCommande.label = Enterprise Manageability diagram |
1061 |
TogafEnterpriseManageabilityDiagramCommande.tooltip = Enterprise Manageability diagram |
1062 |
TogafEnterpriseManageabilityDiagramCommande.image = res/bmp/profile/togafenterprisemanageabilitydiagram16.png |
1063 |
TogafProcessSystemRealizationDiagramCommande.label = Process System Realization diagram |
1064 |
TogafProcessSystemRealizationDiagramCommande.tooltip = Process System Realization diagram |
1065 |
TogafProcessSystemRealizationDiagramCommande.image = res/bmp/profile/togafprocesssystemrealizationdiagram16.png |
1066 |
TogafProjectContextDiagramCommande.label = Project Context diagram |
1067 |
TogafProjectContextDiagramCommande.tooltip = Project Context diagram |
1068 |
TogafProjectContextDiagramCommande.image = res/bmp/profile/togafprojectcontextdiagram16.png |
1069 |
TogafSolutionConceptDiagramCommande.label = Solution Concept diagram |
1070 |
TogafSolutionConceptDiagramCommande.tooltip = Solution Concept diagram |
1071 |
TogafSolutionConceptDiagramCommande.image = res/bmp/profile/togafsolutionconceptdiagram16.png |
1072 |
TogafBenefitsDiagramCommande.label = Benefits diagram |
1073 |
TogafBenefitsDiagramCommande.tooltip = Benefits diagram |
1074 |
TogafBenefitsDiagramCommande.image = res/bmp/profile/togafbenefitsdiagram16.png |
1075 |
TogafBusinessServiceInformationDiagramCommande.label = Business Service Information diagram |
1076 |
TogafBusinessServiceInformationDiagramCommande.tooltip = Business Service Information diagram |
1077 |
TogafBusinessServiceInformationDiagramCommande.image = res/bmp/profile/businessserviceinformationdiagram16.png |
1078 |
TogafUseCaseDiagramCommande.label = Use Case diagram |
1079 |
TogafUseCaseDiagramCommande.tooltip = Use Case diagram |
1080 |
TogafUseCaseDiagramCommande.image = res/bmp/profile/togafusecasediagram16.png |
1081 |
ServiceDataDiagramCommande.label = Logical Data diagram |
1082 |
ServiceDataDiagramCommande.tooltip = Logical Data diagram |
1083 |
ServiceDataDiagramCommande.image = res/bmp/profile/servicedatadiagram16.png |
1084 |
SoftwareEngineeringDiagramCommande.label = Software Engineering diagram |
1085 |
SoftwareEngineeringDiagramCommande.tooltip = Software Engineering diagram |
1086 |
SoftwareEngineeringDiagramCommande.image = res/bmp/modelio/softwareengineering16.png |
1087 |
SoftwareDistributionDiagramCommande.label = Software Distribution diagram |
1088 |
SoftwareDistributionDiagramCommande.tooltip = Software Distribution diagram |
1089 |
SoftwareDistributionDiagramCommande.image = res/bmp/modelio/softwaredistribution16.png |
1090 |
TogafProcessFlowDiagramCommande.label = Process Flow diagram |
1091 |
TogafProcessFlowDiagramCommande.tooltip = Process Flow diagram |
1092 |
TogafProcessFlowDiagramCommande.image = res/bmp/profile/processflowdiagram16.png |
1093 |
TogafFunctionalDecompositionDiagramCommande.label = Functional Decomposition diagram |
1094 |
TogafFunctionalDecompositionDiagramCommande.tooltip = Togaf Functional Decomposition diagram |
1095 |
TogafFunctionalDecompositionDiagramCommande.image = res/bmp/profile/functionaldecompositiondiagram16.png |
1096 |
TogafProductLifeCycleDiagramCommande.label = Product Lifecycle diagram |
1097 |
TogafProductLifeCycleDiagramCommande.tooltip = Product Lifecycle diagram |
1098 |
TogafProductLifeCycleDiagramCommande.image = res/bmp/profile/productlifecyclediagram16.png |
1099 |
TogafGoalObjectiveServiceDiagramCommande.label = Driver/Goal/Objectives diagram |
1100 |
TogafGoalObjectiveServiceDiagramCommande.tooltip = Driver/Goal/Objectives diagram |
1101 |
TogafGoalObjectiveServiceDiagramCommande.image = res/bmp/profile/goalobjectiveservicediagram16.png |
1102 |
TogafBusinessUseCaseDiagramCommande.label = Business Use Case diagram |
1103 |
TogafBusinessUseCaseDiagramCommande.tooltip = Business Use Case diagram |
1104 |
TogafBusinessUseCaseDiagramCommande.image = res/bmp/profile/togafusecasediagram16.png |
1105 |
TogafOrganizationRoleDiagramCommande.label = Organization Role diagram |
1106 |
TogafOrganizationRoleDiagramCommande.tooltip = Organization Role diagram |
1107 |
TogafOrganizationRoleDiagramCommande.image = res/bmp/profile/classhierachydiagram16.png |
1108 |
TogafOrganizationDecompositionDiagramCommande.label = Organization Decomposition diagram |
1109 |
TogafOrganizationDecompositionDiagramCommande.tooltip = Organization Decomposition diagram |
1110 |
TogafOrganizationDecompositionDiagramCommande.image = res/bmp/profile/organizationdecompositiondiagram16.png |
1111 |
TogafEventDiagramCommande.label = Event diagram |
1112 |
TogafEventDiagramCommande.tooltip = Event diagram |
1113 |
TogafEventDiagramCommande.image = res/bmp/profile/togafeventdiagram16.png |
1114 |
TogafDataSecurityDiagramCommande.label = Data Security diagram |
1115 |
TogafDataSecurityDiagramCommande.tooltip = Data Security diagram |
1116 |
TogafDataSecurityDiagramCommande.image = res/bmp/profile/togafdatasecuritydiagram16.png |
1117 |
TogafValueChainDiagramCommande.label = Value Chain diagram |
1118 |
TogafValueChainDiagramCommande.tooltip = Value Chain diagram |
1119 |
TogafValueChainDiagramCommande.image = res/bmp/profile/togafvaluechaindiagram16.png |
1120 |
TogafLocationDiagramCommande.label = Location diagram |
1121 |
TogafLocationDiagramCommande.tooltip = Location diagram |
1122 |
TogafLocationDiagramCommande.image = res/bmp/profile/togaflocationdiagram16.png |
1123 |
TogafEnvironmentAndLocationsDiagramCommande.label = Environment and Locations diagram |
1124 |
TogafEnvironmentAndLocationsDiagramCommande.tooltip = Environment and Locations diagram |
1125 |
TogafEnvironmentAndLocationsDiagramCommande.image = res/bmp/profile/togafenvironmentandlocationsdiagram16.png |
1126 |
TogafNewtorkComputingHardwareDiagramCommande.label = Network Computing Hardware diagram |
1127 |
TogafNewtorkComputingHardwareDiagramCommande.tooltip = Network Computing Hardware diagram |
1128 |
TogafNewtorkComputingHardwareDiagramCommande.image = res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png |
1129 |
TogafPlatformDecompositionDiagramCommande.label = Platform decomposition diagram |
1130 |
TogafPlatformDecompositionDiagramCommande.tooltip = Platform Decomposition diagram |
1131 |
TogafPlatformDecompositionDiagramCommande.image = res/bmp/profile/togafplatformdecompositiondiagram16.png |
1132 |
TogafProcessingDiagramCommande.label = Processing diagram |
1133 |
TogafProcessingDiagramCommande.tooltip = Processing diagram |
1134 |
TogafProcessingDiagramCommande.image = res/bmp/profile/togafprocessingdiagram16.png |
1135 |
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram |
1136 |
TogafCommunicationEngineeringDiagramsCommande.tooltip = Communication Engineering diagram |
1137 |
TogafCommunicationEngineeringDiagramsCommande.image = res/bmp/profile/togafcommunicationengineeringdiagrams16.png |
1138 |
TogafSofwareDistributionDiagramCommande.label = Software Distribution diagram |
1139 |
TogafSofwareDistributionDiagramCommande.tooltip = Software Distribution diagram |
1140 |
TogafSofwareDistributionDiagramCommande.image = res/bmp/profile/sofwaredistributiondiagram16.png |
1141 |
TogafSofwareDistributionDiagramCommande.preview = res/bmp/profile/softwaredistributionpreview.png |
1142 |
TogafMatrixDiagramCommande.label = Traceability diagram |
1143 |
TogafMatrixDiagramCommande.tooltip = Traceability diagram |
1144 |
TogafMatrixDiagramCommande.image = res/bmp/profile/togafmatrixdiagram16.png |
1145 |
|
1146 |
Diagrams.group = Togaf diagrams |
1147 |
Diagrams.groupimage = res/bmp/profile/togafdiagram16.png |
1148 |
TogafPropertyPage.label = Togaf |
1149 |
TogafPropertyPage.image = res/bmp/togaf16.png |