root / branches / modelio3.7.x / src / main / conf / module.properties @ 245
History | View | Annotate | Download (73.2 KB)
| 1 |
ModuleLabel= Togaf Architect |
|---|---|
| 2 |
ModuleDescription= Framework for Entreprise Architecture which provides a comprehensive approach to the design, planning, implementation, and governance of an enterprise information architecture. Version Open Source |
| 3 |
|
| 4 |
command.MigrateModel.label=Migrate Model for Modelio 3.7 |
| 5 |
command.MigrateModel.tooltip=Migrate old annotations |
| 6 |
CreateClassifier.label = Create a classifier from this instance |
| 7 |
CreateClassifier.tooltip = Create a classifier from this instance |
| 8 |
CreateClassifier.image = |
| 9 |
CreateClassifier.group = |
| 10 |
CreateClassifier.groupimage = |
| 11 |
CreateClassifierByLifeline.label = Create a classifier from this instance |
| 12 |
CreateClassifierByLifeline.tooltip = Create a classifier from this instance |
| 13 |
CreateClassifierByLifeline.image = |
| 14 |
CreateClassifierByLifeline.group = |
| 15 |
CreateClassifierByLifeline.groupimage = |
| 16 |
UpdateFromClassifier.label = Update instance or part from an existing classifier |
| 17 |
UpdateFromClassifier.tooltip = Update instance or part from an existing classifier |
| 18 |
UpdateFromClassifier.image = |
| 19 |
UpdateFromClassifier.group = |
| 20 |
UpdateFromClassifier.groupimage = |
| 21 |
UpdateFromClassifierByLifeline.label = Update instance or part from an existing classifier |
| 22 |
UpdateFromClassifierByLifeline.tooltip = Update instance or part from an existing classifier |
| 23 |
UpdateFromClassifierByLifeline.image = |
| 24 |
UpdateFromClassifierByLifeline.group = |
| 25 |
UpdateFromClassifierByLifeline.groupimage = |
| 26 |
CreateOperation.label = Create an operation from this message |
| 27 |
CreateOperation.tooltip = Create an operation from this message |
| 28 |
CreateOperation.image = |
| 29 |
CreateOperation.group = |
| 30 |
CreateOperation.groupimage = |
| 31 |
CreateOperationFromTransition.label = Create an operation from this transition |
| 32 |
CreateOperationFromTransition.tooltip = Create an operation from this transition |
| 33 |
CreateOperationFromTransition.image = |
| 34 |
CreateOperationFromTransition.group = |
| 35 |
CreateOperationFromTransition.groupimage = |
| 36 |
CreateAttribute.label = Create an attribute from this occurence |
| 37 |
CreateAttribute.tooltip = Create an attribute from this occurence |
| 38 |
CreateAttribute.image = |
| 39 |
CreateAttribute.group = |
| 40 |
CreateAttribute.groupimage = |
| 41 |
UpdateClassesFromInterface.label = Update classes from this interface |
| 42 |
UpdateClassesFromInterface.tooltip = Update classes from this interface |
| 43 |
UpdateClassesFromInterface.image = |
| 44 |
UpdateClassesFromInterface.group = |
| 45 |
UpdateClassesFromInterface.groupimage = |
| 46 |
ImplementInterfaces.label = Implement interfaces properties |
| 47 |
ImplementInterfaces.tooltip = Implement interfaces properties |
| 48 |
ImplementInterfaces.image = |
| 49 |
ImplementInterfaces.group = |
| 50 |
ImplementInterfaces.groupimage = |
| 51 |
UnimplementInterfaces.label = Delete interface properties implementations |
| 52 |
UnimplementInterfaces.tooltip = Delete interface properties implementations |
| 53 |
UnimplementInterfaces.image = |
| 54 |
UnimplementInterfaces.group = |
| 55 |
UnimplementInterfaces.groupimage = |
| 56 |
UpdateInternalStructure.label = Update internal structure |
| 57 |
UpdateInternalStructure.tooltip = Update internal structure |
| 58 |
UpdateInternalStructure.image = |
| 59 |
UpdateInternalStructure.group = |
| 60 |
UpdateInternalStructure.groupimage = |
| 61 |
CreateStateMachineFromState.label = Create a state machine from this state |
| 62 |
CreateStateMachineFromState.tooltip = Create a state machine from this state |
| 63 |
CreateStateMachineFromState.image = |
| 64 |
CreateStateMachineFromState.group = |
| 65 |
CreateStateMachineFromState.groupimage = |
| 66 |
UpdateStateFromStateMachine.label = Update state from an existing state machine |
| 67 |
UpdateStateFromStateMachine.tooltip = Update state from an existing state machine |
| 68 |
UpdateStateFromStateMachine.image = |
| 69 |
UpdateStateFromStateMachine.group = |
| 70 |
UpdateStateFromStateMachine.groupimage = |
| 71 |
OpenDocument.label = Open |
| 72 |
OpenDocument.tooltip = Open |
| 73 |
OpenDocument.image = |
| 74 |
OpenDocument.group = |
| 75 |
OpenDocument.groupimage = |
| 76 |
Directory.label = Directory |
| 77 |
Directory.tooltip = Create a directory |
| 78 |
Directory.image = |
| 79 |
Directory.group = |
| 80 |
Directory.groupimage = |
| 81 |
Directory.label = Directory |
| 82 |
Directory.tooltip = Create a directory |
| 83 |
Directory.image = |
| 84 |
Directory.group = |
| 85 |
Directory.groupimage = |
| 86 |
File.label = File |
| 87 |
File.tooltip = Create a file |
| 88 |
File.image = |
| 89 |
File.group = |
| 90 |
File.groupimage = |
| 91 |
File.label = File |
| 92 |
File.tooltip = Create a file |
| 93 |
File.image = |
| 94 |
File.group = |
| 95 |
File.groupimage = |
| 96 |
Mailadress.label = Mail address |
| 97 |
Mailadress.tooltip = Create a mail address |
| 98 |
Mailadress.image = |
| 99 |
Mailadress.group = |
| 100 |
Mailadress.groupimage = |
| 101 |
Url.label = Url |
| 102 |
Url.tooltip = Create an url |
| 103 |
Url.image = |
| 104 |
Url.group = |
| 105 |
Url.groupimage = |
| 106 |
BusinessLayer.label = Business Layer |
| 107 |
BusinessLayer.tooltip = Business Layer |
| 108 |
BusinessLayer.image = res/bmp/profile/businesslayer16.png |
| 109 |
BusinessLayer.group = |
| 110 |
BusinessLayer.groupimage = |
| 111 |
ApplicationLayer.label = Application Layer |
| 112 |
ApplicationLayer.tooltip = Application Layer |
| 113 |
ApplicationLayer.image = res/bmp/profile/applicationlayer16.png |
| 114 |
ApplicationLayer.group = |
| 115 |
ApplicationLayer.groupimage = |
| 116 |
BusinessEntities.label = Business Entities |
| 117 |
BusinessEntities.tooltip = Business Entities |
| 118 |
BusinessEntities.image = res/bmp/profile/businessentity16.png |
| 119 |
BusinessEntities.group = |
| 120 |
BusinessEntities.groupimage = |
| 121 |
DataArchitecture.label = Data Architecture |
| 122 |
DataArchitecture.tooltip = Data Architecture |
| 123 |
DataArchitecture.image = res/bmp/profile/dataarchitecture16.png |
| 124 |
DataArchitecture.group = |
| 125 |
DataArchitecture.groupimage = |
| 126 |
ApplicationArchitecture.label = Application Architecture |
| 127 |
ApplicationArchitecture.tooltip = Application Architecture |
| 128 |
ApplicationArchitecture.image = res/bmp/profile/applicationarchitecture16.png |
| 129 |
ApplicationArchitecture.group = |
| 130 |
ApplicationArchitecture.groupimage = |
| 131 |
BusinessArchitecture.label = Business Architecture |
| 132 |
BusinessArchitecture.tooltip = Business Architecture |
| 133 |
BusinessArchitecture.image = res/bmp/profile/businessarchitecture16.png |
| 134 |
BusinessArchitecture.group = |
| 135 |
BusinessArchitecture.groupimage = |
| 136 |
TechnologyArchitecture.label = Technology Architecture |
| 137 |
TechnologyArchitecture.tooltip = Technology Architecture |
| 138 |
TechnologyArchitecture.image = res/bmp/profile/technologylayer16.png |
| 139 |
TechnologyArchitecture.group = |
| 140 |
TechnologyArchitecture.groupimage = |
| 141 |
Interaction.label = Interaction |
| 142 |
Interaction.tooltip = Interaction |
| 143 |
Interaction.image = |
| 144 |
Interaction.group = |
| 145 |
Interaction.groupimage = |
| 146 |
CommunicationInteraction.label = Communication Interaction |
| 147 |
CommunicationInteraction.tooltip = Communication Interaction |
| 148 |
CommunicationInteraction.image = |
| 149 |
CommunicationInteraction.group = |
| 150 |
CommunicationInteraction.groupimage = |
| 151 |
BPMNBehavior.label = BPMN Behavior |
| 152 |
BPMNBehavior.tooltip = BPMN Behavior |
| 153 |
BPMNBehavior.image = |
| 154 |
BPMNBehavior.group = |
| 155 |
BPMNBehavior.groupimage = |
| 156 |
TechnologyDomain.label = Technology Domain |
| 157 |
TechnologyDomain.tooltip = Technology Domain |
| 158 |
TechnologyDomain.image = res/bmp/profile/technologydomain16.png |
| 159 |
TechnologyDomain.group = |
| 160 |
TechnologyDomain.groupimage = |
| 161 |
Server.label = Server |
| 162 |
Server.tooltip = Server |
| 163 |
Server.image = res/bmp/profile/server16.png |
| 164 |
Server.group = Device |
| 165 |
Server.groupimage = res/bmp/profile/internet16.png |
| 166 |
Workstation.label = Workstation |
| 167 |
Workstation.tooltip = Workstation |
| 168 |
Workstation.image = res/bmp/profile/workstation16.png |
| 169 |
Workstation.group = Device |
| 170 |
Workstation.groupimage = |
| 171 |
Internet.label = Internet |
| 172 |
Internet.tooltip = Internet |
| 173 |
Internet.image = res/bmp/profile/internet16.png |
| 174 |
Internet.group = Device |
| 175 |
Internet.groupimage = res/bmp/profile/internet16.png |
| 176 |
Router.label = Router |
| 177 |
Router.tooltip = Router |
| 178 |
Router.image = res/bmp/profile/router16.png |
| 179 |
Router.group = Device |
| 180 |
Router.groupimage = res/bmp/profile/internet16.png |
| 181 |
Switch.label = Switch |
| 182 |
Switch.tooltip = Switch |
| 183 |
Switch.image = res/bmp/profile/switch16.png |
| 184 |
Switch.group = Device |
| 185 |
Switch.groupimage = res/bmp/profile/internet16.png |
| 186 |
NetworkNode.label = Network Node |
| 187 |
NetworkNode.tooltip = Network Node |
| 188 |
NetworkNode.image = res/bmp/profile/networknode16.png |
| 189 |
NetworkNode.group = Device |
| 190 |
NetworkNode.groupimage = res/bmp/profile/internet16.png |
| 191 |
TechnologyArtifact.label = Technology Artifact |
| 192 |
TechnologyArtifact.tooltip = Technology Artifact |
| 193 |
TechnologyArtifact.image = res/bmp/profile/artifact16.png |
| 194 |
TechnologyArtifact.group = |
| 195 |
TechnologyArtifact.groupimage = |
| 196 |
OrganizationDomain.label = Organization Domain |
| 197 |
OrganizationDomain.tooltip = Organization Domain |
| 198 |
OrganizationDomain.image = res/bmp/profile/organizationsdomain16.png |
| 199 |
OrganizationDomain.group = Organization |
| 200 |
OrganizationDomain.groupimage = res/bmp/profile/organizationsdomain16.png |
| 201 |
OrganizationUnit.label = Organization Unit |
| 202 |
OrganizationUnit.tooltip = Organization Unit |
| 203 |
OrganizationUnit.image = res/bmp/profile/organizationsunit16.png |
| 204 |
OrganizationUnit.group = Organization |
| 205 |
OrganizationUnit.groupimage = |
| 206 |
ExternalActor.label = External Actor |
| 207 |
ExternalActor.tooltip = External Actor |
| 208 |
ExternalActor.image = res/bmp/profile/externalactor16.png |
| 209 |
ExternalActor.group = Participant |
| 210 |
ExternalActor.groupimage = res/bmp/profile/externalactor16.png |
| 211 |
InternalActor.label = Internal Actor |
| 212 |
InternalActor.tooltip = Internal Actor |
| 213 |
InternalActor.image = res/bmp/profile/internalactor16.png |
| 214 |
InternalActor.group = Participant |
| 215 |
InternalActor.groupimage = res/bmp/profile/externalactor16.png |
| 216 |
ExternalRole.label = External Role |
| 217 |
ExternalRole.tooltip = External Role |
| 218 |
ExternalRole.image = res/bmp/profile/externalrole16.png |
| 219 |
ExternalRole.group = Participant |
| 220 |
ExternalRole.groupimage = res/bmp/profile/externalactor16.png |
| 221 |
InternalRole.label = Internal Role |
| 222 |
InternalRole.tooltip = Internal Role |
| 223 |
InternalRole.image = res/bmp/profile/internalrole16.png |
| 224 |
InternalRole.group = Participant |
| 225 |
InternalRole.groupimage = res/bmp/profile/externalactor16.png |
| 226 |
Event.label = Event |
| 227 |
Event.tooltip = Event |
| 228 |
Event.image = res/bmp/profile/event16.png |
| 229 |
Event.group = |
| 230 |
Event.groupimage = |
| 231 |
BusinessProcess.label = Business Process |
| 232 |
BusinessProcess.tooltip = Business Process |
| 233 |
BusinessProcess.image = res/bmp/profile/togafprocess16.png |
| 234 |
BusinessProcess.group = |
| 235 |
BusinessProcess.groupimage = |
| 236 |
MacroProcess.label = Macro Process |
| 237 |
MacroProcess.tooltip = Macro Process |
| 238 |
MacroProcess.image = res/bmp/profile/macroprocessus16.png |
| 239 |
MacroProcess.group = |
| 240 |
MacroProcess.groupimage = |
| 241 |
BusinessCollaboration.label = Business Collaboration |
| 242 |
BusinessCollaboration.tooltip = Business Collaboration |
| 243 |
BusinessCollaboration.image = res/bmp/profile/businesscollaboration16.png |
| 244 |
BusinessCollaboration.group = |
| 245 |
BusinessCollaboration.groupimage = |
| 246 |
BusinessService.label = Business Service |
| 247 |
BusinessService.tooltip = Business Service |
| 248 |
BusinessService.image = res/bmp/profile/businessservice16.png |
| 249 |
BusinessService.group = |
| 250 |
BusinessService.groupimage = |
| 251 |
ISService.label = IS Service |
| 252 |
ISService.tooltip = IS Service |
| 253 |
ISService.image = res/bmp/profile/isservice16.png |
| 254 |
ISService.group = |
| 255 |
ISService.groupimage = |
| 256 |
Function.label = Function |
| 257 |
Function.tooltip = Function |
| 258 |
Function.image = res/bmp/profile/functionservice16.png |
| 259 |
Function.group = |
| 260 |
Function.groupimage = |
| 261 |
Product.label = Product |
| 262 |
Product.tooltip = Product |
| 263 |
Product.image = res/bmp/profile/togafproduct16.png |
| 264 |
Product.group = |
| 265 |
Product.groupimage = |
| 266 |
BusinessCapability.label = Business Capability |
| 267 |
BusinessCapability.tooltip = Business Capability |
| 268 |
BusinessCapability.image = res/bmp/profile/businesscapabilityservice16.png |
| 269 |
BusinessCapability.group = |
| 270 |
BusinessCapability.groupimage = |
| 271 |
Operation.label = Operation |
| 272 |
Operation.tooltip = Operation |
| 273 |
Operation.image = res/bmp/profile/businessserviceoperation16.png |
| 274 |
Operation.group = |
| 275 |
Operation.groupimage = |
| 276 |
ISServiceOperation.label = IS Service Operation |
| 277 |
ISServiceOperation.tooltip = IS Service Operation |
| 278 |
ISServiceOperation.image = res/bmp/profile/isserviceoperation16.png |
| 279 |
ISServiceOperation.group = |
| 280 |
ISServiceOperation.groupimage = |
| 281 |
Location.label = Location |
| 282 |
Location.tooltip = Location |
| 283 |
Location.image = res/bmp/profile/location16.png |
| 284 |
Location.group = Location |
| 285 |
Location.groupimage = res/bmp/profile/location16.png |
| 286 |
Headquarter.label = Headquarter |
| 287 |
Headquarter.tooltip = Headquarter |
| 288 |
Headquarter.image = res/bmp/profile/headquarterlocation16.png |
| 289 |
Headquarter.group = Location |
| 290 |
Headquarter.groupimage = res/bmp/profile/location16.png |
| 291 |
ServiceContract.label = Service Contract |
| 292 |
ServiceContract.tooltip = Service Contract |
| 293 |
ServiceContract.image = res/bmp/profile/servicecontract16.png |
| 294 |
ServiceContract.group = |
| 295 |
ServiceContract.groupimage = |
| 296 |
ApplicationDomain.label = Application Domain |
| 297 |
ApplicationDomain.tooltip = Application Domain |
| 298 |
ApplicationDomain.image = res/bmp/profile/applicationdomain16.png |
| 299 |
ApplicationDomain.group = |
| 300 |
ApplicationDomain.groupimage = |
| 301 |
System.label = System |
| 302 |
System.tooltip = System |
| 303 |
System.image = res/bmp/profile/system16.png |
| 304 |
System.group = System/Application |
| 305 |
System.groupimage = res/bmp/profile/system16.png |
| 306 |
SystemFederation.label = System Federation |
| 307 |
SystemFederation.tooltip = System Federation |
| 308 |
SystemFederation.image = res/bmp/profile/systemfederation16.png |
| 309 |
SystemFederation.group = System/Application |
| 310 |
SystemFederation.groupimage = res/bmp/profile/system16.png |
| 311 |
EnterpriseSystem.label = Enterprise System |
| 312 |
EnterpriseSystem.tooltip = Enterprise System |
| 313 |
EnterpriseSystem.image = res/bmp/profile/enterprisesystem16.png |
| 314 |
EnterpriseSystem.group = System/Application |
| 315 |
EnterpriseSystem.groupimage = res/bmp/profile/system16.png |
| 316 |
Application.label = Application |
| 317 |
Application.tooltip = Application |
| 318 |
Application.image = res/bmp/profile/application16.png |
| 319 |
Application.group = System/Application |
| 320 |
Application.groupimage = res/bmp/profile/system16.png |
| 321 |
ServiceComponent.label = Service Component |
| 322 |
ServiceComponent.tooltip = Service Component |
| 323 |
ServiceComponent.image = res/bmp/profile/applicationcomponent16.png |
| 324 |
ServiceComponent.group = Service Component |
| 325 |
ServiceComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 326 |
InteractionComponent.label = Interaction Component |
| 327 |
InteractionComponent.tooltip = Interaction Component |
| 328 |
InteractionComponent.image = res/bmp/profile/interactioncomponent16.png |
| 329 |
InteractionComponent.group = Service Component |
| 330 |
InteractionComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 331 |
ProcessComponent.label = Process Component |
| 332 |
ProcessComponent.tooltip = Process Component |
| 333 |
ProcessComponent.image = res/bmp/profile/processcomponent16.png |
| 334 |
ProcessComponent.group = Service Component |
| 335 |
ProcessComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 336 |
IntermediaryComponent.label = Intermediary Component |
| 337 |
IntermediaryComponent.tooltip = Intermediary Component |
| 338 |
IntermediaryComponent.image = res/bmp/profile/intermediarycomponent16.png |
| 339 |
IntermediaryComponent.group = Service Component |
| 340 |
IntermediaryComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 341 |
PublicComponent.label = Public Component |
| 342 |
PublicComponent.tooltip = Public Component |
| 343 |
PublicComponent.image = res/bmp/profile/publiccomponent16.png |
| 344 |
PublicComponent.group = Service Component |
| 345 |
PublicComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 346 |
UtilityComponent.label = Utility Component |
| 347 |
UtilityComponent.tooltip = Utility Component |
| 348 |
UtilityComponent.image = res/bmp/profile/utilitycomponent16.png |
| 349 |
UtilityComponent.group = Service Component |
| 350 |
UtilityComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 351 |
EntityComponent.label = Entity Component |
| 352 |
EntityComponent.tooltip = Entity Component |
| 353 |
EntityComponent.image = res/bmp/profile/entitycomponent16.png |
| 354 |
EntityComponent.group = Service Component |
| 355 |
EntityComponent.groupimage = res/bmp/profile/applicationcomponent16.png |
| 356 |
Database.label = Database |
| 357 |
Database.tooltip = Database |
| 358 |
Database.image = res/bmp/profile/databaseapplicationcomponent16.png |
| 359 |
Database.group = Service Component |
| 360 |
Database.groupimage = res/bmp/profile/applicationcomponent16.png |
| 361 |
ApplicationCollaboration.label = Application Collaboration |
| 362 |
ApplicationCollaboration.tooltip = Application Collaboration |
| 363 |
ApplicationCollaboration.image = res/bmp/profile/applicationcollaboration16.png |
| 364 |
ApplicationCollaboration.group = |
| 365 |
ApplicationCollaboration.groupimage = |
| 366 |
ApplicationInstance.label = Application Instance |
| 367 |
ApplicationInstance.tooltip = Application Instance |
| 368 |
ApplicationInstance.image = res/bmp/profile/applicationcomponentinstance16.png |
| 369 |
ApplicationInstance.group = |
| 370 |
ApplicationInstance.groupimage = |
| 371 |
Message.label = Message |
| 372 |
Message.tooltip = Message |
| 373 |
Message.image = res/bmp/profile/servicedata16.png |
| 374 |
Message.group = |
| 375 |
Message.groupimage = |
| 376 |
MessageFragment.label = Message Fragment |
| 377 |
MessageFragment.tooltip = Message Fragment |
| 378 |
MessageFragment.image = res/bmp/profile/servicedatafragment16.png |
| 379 |
MessageFragment.group = |
| 380 |
MessageFragment.groupimage = |
| 381 |
ApplicationAttribute.label = Application Attribute |
| 382 |
ApplicationAttribute.tooltip = Application Attribute |
| 383 |
ApplicationAttribute.image = res/bmp/profile/businessattribute16.png |
| 384 |
ApplicationAttribute.group = |
| 385 |
ApplicationAttribute.groupimage = |
| 386 |
ApplicationOperation.label = Application Operation |
| 387 |
ApplicationOperation.tooltip = Application Operation |
| 388 |
ApplicationOperation.image = res/bmp/profile/businessoperation16.png |
| 389 |
ApplicationOperation.group = |
| 390 |
ApplicationOperation.groupimage = |
| 391 |
Provided.label = Provided |
| 392 |
Provided.tooltip = Provided |
| 393 |
Provided.image = res/bmp/profile/serviceaccessprovide16.png |
| 394 |
Provided.group = |
| 395 |
Provided.groupimage = |
| 396 |
Required.label = Required |
| 397 |
Required.tooltip = Required |
| 398 |
Required.image = res/bmp/profile/serviceaccessrequired16.png |
| 399 |
Required.group = |
| 400 |
Required.groupimage = |
| 401 |
InformationDomain.label = Information Domain |
| 402 |
InformationDomain.tooltip = Information Domain |
| 403 |
InformationDomain.image = res/bmp/profile/businessdomain16.png |
| 404 |
InformationDomain.group = |
| 405 |
InformationDomain.groupimage = |
| 406 |
BusinessEntity.label = Business Entity |
| 407 |
BusinessEntity.tooltip = Business Entity |
| 408 |
BusinessEntity.image = res/bmp/profile/businessentitys16.png |
| 409 |
BusinessEntity.group = |
| 410 |
BusinessEntity.groupimage = |
| 411 |
Attribute.label = Attribute |
| 412 |
Attribute.tooltip = Attribute |
| 413 |
Attribute.image = res/bmp/profile/businessattribute16.png |
| 414 |
Attribute.group = |
| 415 |
Attribute.groupimage = |
| 416 |
Operation.label = Operation |
| 417 |
Operation.tooltip = Operation |
| 418 |
Operation.image = res/bmp/profile/businessoperation16.png |
| 419 |
Operation.group = |
| 420 |
Operation.groupimage = |
| 421 |
Enumeration.label = Enumeration |
| 422 |
Enumeration.tooltip = Enumeration |
| 423 |
Enumeration.image = res/bmp/profile/businessenumeration16.png |
| 424 |
Enumeration.group = |
| 425 |
Enumeration.groupimage = |
| 426 |
EnumerationLiteral.label = Enumeration Literal |
| 427 |
EnumerationLiteral.tooltip = Enumeration Literal |
| 428 |
EnumerationLiteral.image = res/bmp/modelio/umlenumerationlitteral.png |
| 429 |
EnumerationLiteral.group = |
| 430 |
EnumerationLiteral.groupimage = |
| 431 |
BusinessDataType.label = Business Data Type |
| 432 |
BusinessDataType.tooltip = Business Data Type |
| 433 |
BusinessDataType.image = res/bmp/profile/businessdatatype16.png |
| 434 |
BusinessDataType.group = |
| 435 |
BusinessDataType.groupimage = |
| 436 |
Lifecycle.label = Lifecycle |
| 437 |
Lifecycle.tooltip = Lifecycle |
| 438 |
Lifecycle.image = res/bmp/profile/entitylifecycle16.png |
| 439 |
Lifecycle.group = |
| 440 |
Lifecycle.groupimage = |
| 441 |
Precondition.label = Precondition |
| 442 |
Precondition.tooltip = Precondition |
| 443 |
Precondition.image = res/bmp/profile/precondition16.png |
| 444 |
Precondition.group = |
| 445 |
Precondition.groupimage = |
| 446 |
Postcondition.label = Postcondition |
| 447 |
Postcondition.tooltip = Postcondition |
| 448 |
Postcondition.image = res/bmp/profile/postcondition16.png |
| 449 |
Postcondition.group = |
| 450 |
Postcondition.groupimage = |
| 451 |
Invariant.label = Invariant |
| 452 |
Invariant.tooltip = Invariant |
| 453 |
Invariant.image = res/bmp/profile/invariant16.png |
| 454 |
Invariant.group = |
| 455 |
Invariant.groupimage = |
| 456 |
BusinessToExchangeDataTransformation.label = Message generation from Business Entities |
| 457 |
BusinessToExchangeDataTransformation.tooltip = Message generation from Business Entities |
| 458 |
BusinessToExchangeDataTransformation.image = res/bmp/exchangedatacommande16.png |
| 459 |
BusinessToExchangeDataTransformation.group = Model transformation |
| 460 |
BusinessToExchangeDataTransformation.groupimage = res/bmp/exchangedatacommande16.png |
| 461 |
BusinessToPersistantTransformation.label = Data Model generation from Business Entities |
| 462 |
BusinessToPersistantTransformation.tooltip = Data Model generation from Business Entities |
| 463 |
BusinessToPersistantTransformation.image = res/bmp/businessentityscommande16.png |
| 464 |
BusinessToPersistantTransformation.group = Model transformation |
| 465 |
BusinessToPersistantTransformation.groupimage = res/bmp/exchangedatacommande16.png |
| 466 |
ArchitectureToJavaTransformation.label = Transformation of Architecture model to Java implementation |
| 467 |
ArchitectureToJavaTransformation.tooltip = Model transformation |
| 468 |
ArchitectureToJavaTransformation.image = res/bmp/javacommande16.png |
| 469 |
ArchitectureToJavaTransformation.group = Model transformation |
| 470 |
ArchitectureToJavaTransformation.groupimage = res/bmp/exchangedatacommande16.png |
| 471 |
ProductBusinessInteractionMatrix.label = Business - Interaction Matrix |
| 472 |
ProductBusinessInteractionMatrix.tooltip = Business - Interaction Matrix |
| 473 |
ProductBusinessInteractionMatrix.image = res/bmp/matrix16.png |
| 474 |
ProductBusinessInteractionMatrix.group = Document production|Matrices |
| 475 |
ProductBusinessInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 476 |
ProductActorRoleMatrix.label = Actor - Role Matrix |
| 477 |
ProductActorRoleMatrix.tooltip = Actor - Role Matrix |
| 478 |
ProductActorRoleMatrix.image = res/bmp/matrix16.png |
| 479 |
ProductActorRoleMatrix.group = Document production|Matrices |
| 480 |
ProductActorRoleMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 481 |
ProductDataEntityBusinessFunctionMatrix.label = Data Entity - Business Function Matrix |
| 482 |
ProductDataEntityBusinessFunctionMatrix.tooltip = Data Entity - Business Function Matrix |
| 483 |
ProductDataEntityBusinessFunctionMatrix.image = res/bmp/matrix16.png |
| 484 |
ProductDataEntityBusinessFunctionMatrix.group = Document production|Matrices |
| 485 |
ProductDataEntityBusinessFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 486 |
ProductSystemDataMatrix.label = Product - System - Data Matrix |
| 487 |
ProductSystemDataMatrix.tooltip = Product - System - Data Matrix |
| 488 |
ProductSystemDataMatrix.image = res/bmp/matrix16.png |
| 489 |
ProductSystemDataMatrix.group = Document production|Matrices |
| 490 |
ProductSystemDataMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 491 |
ProductSystemOrganizationMatrix.label = System - Organization Matrix |
| 492 |
ProductSystemOrganizationMatrix.tooltip = Label=System - Organization Matrix |
| 493 |
ProductSystemOrganizationMatrix.image = res/bmp/matrix16.png |
| 494 |
ProductSystemOrganizationMatrix.group = Document production|Matrices |
| 495 |
ProductSystemOrganizationMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 496 |
ProductRoleSystemMatrix.label = Role - System Matrix |
| 497 |
ProductRoleSystemMatrix.tooltip = Role - System Matrix |
| 498 |
ProductRoleSystemMatrix.image = res/bmp/matrix16.png |
| 499 |
ProductRoleSystemMatrix.group = Document production|Matrices |
| 500 |
ProductRoleSystemMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 501 |
ProductSystemFunctionMatrix.label = System - Function Matrix |
| 502 |
ProductSystemFunctionMatrix.tooltip = System - Function Matrix |
| 503 |
ProductSystemFunctionMatrix.image = res/bmp/matrix16.png |
| 504 |
ProductSystemFunctionMatrix.group = Document production|Matrices |
| 505 |
ProductSystemFunctionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 506 |
ProductApplicationInteractionMatrix.label = Application - Interaction Matrix |
| 507 |
ProductApplicationInteractionMatrix.tooltip = Application - Interaction Matrix |
| 508 |
ProductApplicationInteractionMatrix.image = res/bmp/matrix16.png |
| 509 |
ProductApplicationInteractionMatrix.group = Document production|Matrices |
| 510 |
ProductApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png|res/bmp/matrix16.png |
| 511 |
ProductOrganizationCatalog.label = Organization Catalog |
| 512 |
ProductOrganizationCatalog.tooltip = Organization Catalog |
| 513 |
ProductOrganizationCatalog.image = res/bmp/catalog16.png |
| 514 |
ProductOrganizationCatalog.group = Document production|Catalogs |
| 515 |
ProductOrganizationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 516 |
ProductRoleCatalog.label = Role - Actor Catalog |
| 517 |
ProductRoleCatalog.tooltip = Role - Actor Catalog |
| 518 |
ProductRoleCatalog.image = res/bmp/catalog16.png |
| 519 |
ProductRoleCatalog.group = Document production|Catalogs |
| 520 |
ProductRoleCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 521 |
ProductGoalCatalog.label = Driver - Goal - Objective Catalog |
| 522 |
ProductGoalCatalog.tooltip = Driver - Goal - Objective Catalog |
| 523 |
ProductGoalCatalog.image = res/bmp/catalog16.png |
| 524 |
ProductGoalCatalog.group = Document production|Catalogs |
| 525 |
ProductGoalCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 526 |
ProductBusinessCatalog.label = BusinessService - Function Catalog |
| 527 |
ProductBusinessCatalog.tooltip = Business Service - Function Catalog |
| 528 |
ProductBusinessCatalog.image = res/bmp/catalog16.png |
| 529 |
ProductBusinessCatalog.group = Document production|Catalogs |
| 530 |
ProductBusinessCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 531 |
ProductLocationCatalog.label = Location Catalog |
| 532 |
ProductLocationCatalog.tooltip = Location Catalog |
| 533 |
ProductLocationCatalog.image = res/bmp/catalog16.png |
| 534 |
ProductLocationCatalog.group = Document production|Catalogs |
| 535 |
ProductLocationCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 536 |
ProductProcessEventControlProductCatalog.label = Process - Event - Control - Product Catalog |
| 537 |
ProductProcessEventControlProductCatalog.tooltip = Process - Event - Control - Product Catalog |
| 538 |
ProductProcessEventControlProductCatalog.image = res/bmp/catalog16.png |
| 539 |
ProductProcessEventControlProductCatalog.group = Document production|Catalogs |
| 540 |
ProductProcessEventControlProductCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 541 |
BusinessEntityCatalog.label = Business Entities Catalog |
| 542 |
BusinessEntityCatalog.tooltip = Business Entities Catalog |
| 543 |
BusinessEntityCatalog.image = res/bmp/extensioncatalog16.png |
| 544 |
BusinessEntityCatalog.group = Document production|Catalogs (Modelio) |
| 545 |
BusinessEntityCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 546 |
UseCasesCatalog.label = Use Cases Catalog |
| 547 |
UseCasesCatalog.tooltip = Use Cases Catalog |
| 548 |
UseCasesCatalog.image = res/bmp/extensioncatalog16.png |
| 549 |
UseCasesCatalog.group = Document production|Catalogs (Modelio) |
| 550 |
UseCasesCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 551 |
InformationServiceCatalog.label = Information Service Catalog |
| 552 |
InformationServiceCatalog.tooltip = Information Service Catalog |
| 553 |
InformationServiceCatalog.image = res/bmp/extensioncatalog16.png |
| 554 |
InformationServiceCatalog.group = Document production|Catalogs (Modelio) |
| 555 |
InformationServiceCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 556 |
ComponentCatalog.label = Component Catalog |
| 557 |
ComponentCatalog.tooltip = Component Catalog |
| 558 |
ComponentCatalog.image = res/bmp/extensioncatalog16.png |
| 559 |
ComponentCatalog.group = Document production|Catalogs (Modelio) |
| 560 |
ComponentCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 561 |
ServiceDataCatalog.label = Service Data Catalog |
| 562 |
ServiceDataCatalog.tooltip = Service Data Catalog |
| 563 |
ServiceDataCatalog.image = res/bmp/extensioncatalog16.png |
| 564 |
ServiceDataCatalog.group = Document production|Catalogs (Modelio) |
| 565 |
ServiceDataCatalog.groupimage = res/bmp/matrix16.png|res/bmp/catalog16.png |
| 566 |
CreateBusinessInteractionMatrix.label = Business - Interaction Matrix |
| 567 |
CreateBusinessInteractionMatrix.tooltip = Create Business - Interaction Matrix |
| 568 |
CreateBusinessInteractionMatrix.image = res/bmp/staticmatrix16.png |
| 569 |
CreateBusinessInteractionMatrix.group = Traceability Matrices |
| 570 |
CreateBusinessInteractionMatrix.groupimage = res/bmp/staticmatrix16.png |
| 571 |
CreateActorRoleMatrix.label = Actor - Role Matrix |
| 572 |
CreateActorRoleMatrix.tooltip = Create Actor - Role Matrix |
| 573 |
CreateActorRoleMatrix.image = res/bmp/staticmatrix16.png |
| 574 |
CreateActorRoleMatrix.group = Traceability Matrices |
| 575 |
CreateActorRoleMatrix.groupimage = res/bmp/staticmatrix16.png |
| 576 |
CreateDataEntityBusinessFunctionMatrix.label = DataEntity - BusinessFunction Matrix |
| 577 |
CreateDataEntityBusinessFunctionMatrix.tooltip = Create DataEntity - BusinessFunction Matrix |
| 578 |
CreateDataEntityBusinessFunctionMatrix.image = res/bmp/staticmatrix16.png |
| 579 |
CreateDataEntityBusinessFunctionMatrix.group = Traceability Matrices |
| 580 |
CreateDataEntityBusinessFunctionMatrix.groupimage = res/bmp/staticmatrix16.png |
| 581 |
CreateSystemDataMatrix.label = System - Data Matrix |
| 582 |
CreateSystemDataMatrix.tooltip = Create System - Data Matrix |
| 583 |
CreateSystemDataMatrix.image = res/bmp/staticmatrix16.png |
| 584 |
CreateSystemDataMatrix.group = Traceability Matrices |
| 585 |
CreateSystemDataMatrix.groupimage = res/bmp/staticmatrix16.png |
| 586 |
CreateSystemOrganizationMatrix.label = System - Organization Matrix |
| 587 |
CreateSystemOrganizationMatrix.tooltip = Create System - Organization Matrix |
| 588 |
CreateSystemOrganizationMatrix.image = res/bmp/staticmatrix16.png |
| 589 |
CreateSystemOrganizationMatrix.group = Traceability Matrices |
| 590 |
CreateSystemOrganizationMatrix.groupimage = res/bmp/staticmatrix16.png |
| 591 |
CreateRoleSystemMatrix.label = Role - System Matrix |
| 592 |
CreateRoleSystemMatrix.tooltip = Create Role - System Matrix |
| 593 |
CreateRoleSystemMatrix.image = res/bmp/staticmatrix16.png |
| 594 |
CreateRoleSystemMatrix.group = Traceability Matrices |
| 595 |
CreateRoleSystemMatrix.groupimage = res/bmp/staticmatrix16.png |
| 596 |
CreateSystemFunctionMatrix.label = System - Function Matrix |
| 597 |
CreateSystemFunctionMatrix.tooltip = Create System - Function Matrix |
| 598 |
CreateSystemFunctionMatrix.image = res/bmp/staticmatrix16.png |
| 599 |
CreateSystemFunctionMatrix.group = Traceability Matrices |
| 600 |
CreateSystemFunctionMatrix.groupimage = res/bmp/staticmatrix16.png |
| 601 |
CreateApplicationInteractionMatrix.label = Application - Interaction Matrix |
| 602 |
CreateApplicationInteractionMatrix.tooltip = Create Application - Interaction Matrix |
| 603 |
CreateApplicationInteractionMatrix.image = res/bmp/staticmatrix16.png |
| 604 |
CreateApplicationInteractionMatrix.group = Traceability Matrices |
| 605 |
CreateApplicationInteractionMatrix.groupimage = res/bmp/matrix16.png |
| 606 |
|
| 607 |
|
| 608 |
TechnologyArchitectureDomainDiagramCommande.label = Technology Domain |
| 609 |
TechnologyArchitectureDomainDiagramCommande.tooltip = Technology Domain |
| 610 |
TechnologyArchitectureDomainDiagramCommande.image = res/bmp/profile/technologydomain16.png |
| 611 |
DeploymentServerDiagramCommande.label = Server |
| 612 |
DeploymentServerDiagramCommande.tooltip = Server |
| 613 |
DeploymentServerDiagramCommande.image = res/bmp/profile/server16.png |
| 614 |
DeploymentWorkStationDiagramCommande.label = Workstation |
| 615 |
DeploymentWorkStationDiagramCommande.tooltip = Workstation |
| 616 |
DeploymentWorkStationDiagramCommande.image = res/bmp/profile/workstation16.png |
| 617 |
DeploymentInternetDiagramCommande.label = Internet |
| 618 |
DeploymentInternetDiagramCommande.tooltip = Internet |
| 619 |
DeploymentInternetDiagramCommande.image = res/bmp/profile/internet16.png |
| 620 |
DeploymentRouterDiagramCommande.label = Router |
| 621 |
DeploymentRouterDiagramCommande.tooltip = Router |
| 622 |
DeploymentRouterDiagramCommande.image = res/bmp/profile/router16.png |
| 623 |
DeploymentSwitchDiagramCommande.label = Switch |
| 624 |
DeploymentSwitchDiagramCommande.tooltip = Switch |
| 625 |
DeploymentSwitchDiagramCommande.image = res/bmp/profile/switch16.png |
| 626 |
DeploymentNetworkNodeDiagramCommande.label = Network Node |
| 627 |
DeploymentNetworkNodeDiagramCommande.tooltip = Network Node |
| 628 |
DeploymentNetworkNodeDiagramCommande.image = res/bmp/profile/networknode16.png |
| 629 |
BusinessOrganizationDomainDiagramCommande.label = Organization Domain |
| 630 |
BusinessOrganizationDomainDiagramCommande.tooltip = Organization Domain |
| 631 |
BusinessOrganizationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png |
| 632 |
TogafExternalActorDiagramCommande.label = External Actor |
| 633 |
TogafExternalActorDiagramCommande.tooltip = External Actor |
| 634 |
TogafExternalActorDiagramCommande.image = res/bmp/profile/externalactor16.png |
| 635 |
TogafInternalActorDiagramCommande.label = Internal Actor |
| 636 |
TogafInternalActorDiagramCommande.tooltip = Internal Actor |
| 637 |
TogafInternalActorDiagramCommande.image = res/bmp/profile/internalactor16.png |
| 638 |
TogafExternalRoleDiagramCommande.label = External Role |
| 639 |
TogafExternalRoleDiagramCommande.tooltip = External Role |
| 640 |
TogafExternalRoleDiagramCommande.image = res/bmp/profile/externalrole16.png |
| 641 |
TogafInternalRoleDiagramCommande.label = Internal Role |
| 642 |
TogafInternalRoleDiagramCommande.tooltip = Internal Role |
| 643 |
TogafInternalRoleDiagramCommande.image = res/bmp/profile/internalrole16.png |
| 644 |
EventDiagramCommande.label = Event |
| 645 |
EventDiagramCommande.tooltip = Event |
| 646 |
EventDiagramCommande.image = res/bmp/profile/event16.png |
| 647 |
TogafOrganizationUnitDiagramCommande.label = Organization Unit |
| 648 |
TogafOrganizationUnitDiagramCommande.tooltip = Organization Unit |
| 649 |
TogafOrganizationUnitDiagramCommande.image = res/bmp/profile/organizationsunit16.png |
| 650 |
TogafProcessDiagramCommande.label = Business Process |
| 651 |
TogafProcessDiagramCommande.tooltip = Business Process |
| 652 |
TogafProcessDiagramCommande.image = res/bmp/profile/togafprocess16.png |
| 653 |
TogafMacroProcessDiagramCommande.label = Macro Process |
| 654 |
TogafMacroProcessDiagramCommande.tooltip = Macro Process |
| 655 |
TogafMacroProcessDiagramCommande.image = res/bmp/profile/macroprocessus16.png |
| 656 |
TogafBusinessCollaborationDiagramCommande.label = Business Collaboration |
| 657 |
TogafBusinessCollaborationDiagramCommande.tooltip = Business Collaboration |
| 658 |
TogafBusinessCollaborationDiagramCommande.image = res/bmp/profile/businesscollaboration16.png |
| 659 |
TogafFunctionDiagramCommande.label = Function |
| 660 |
TogafFunctionDiagramCommande.tooltip = Function |
| 661 |
TogafFunctionDiagramCommande.image = res/bmp/profile/functionservice16.png |
| 662 |
TogafBusinessServiceDiagramCommande.label = Business Service |
| 663 |
TogafBusinessServiceDiagramCommande.tooltip = Business Service |
| 664 |
TogafBusinessServiceDiagramCommande.image = res/bmp/profile/businessservice16.png |
| 665 |
TogafBusinessCapabilityDiagramCommande.label = Business Capability |
| 666 |
TogafBusinessCapabilityDiagramCommande.tooltip = Business Capability |
| 667 |
TogafBusinessCapabilityDiagramCommande.image = res/bmp/profile/businesscapabilityservice16.png |
| 668 |
TogafBusinessOperationDiagramCommande.label = Operation |
| 669 |
TogafBusinessOperationDiagramCommande.tooltip = Operation |
| 670 |
TogafBusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png |
| 671 |
TogafProductDiagramCommande.label = Product |
| 672 |
TogafProductDiagramCommande.tooltip = Product |
| 673 |
TogafProductDiagramCommande.image = res/bmp/profile/togafproduct16.png |
| 674 |
LocationDiagramCommande.label = Location |
| 675 |
LocationDiagramCommande.tooltip = Location |
| 676 |
LocationDiagramCommande.image = res/bmp/profile/location16.png |
| 677 |
HeadquarterLocationDiagramCommande.label = Headquarter |
| 678 |
HeadquarterLocationDiagramCommande.tooltip = Headquarter |
| 679 |
HeadquarterLocationDiagramCommande.image = res/bmp/profile/headquarterlocation16.png |
| 680 |
TogafServiceContractDiagramCommande.label = Service Contract |
| 681 |
TogafServiceContractDiagramCommande.tooltip = Service Contract |
| 682 |
TogafServiceContractDiagramCommande.image = res/bmp/profile/servicecontract16.png |
| 683 |
SystemApplicationComponentDiagramCommande.label = System |
| 684 |
SystemApplicationComponentDiagramCommande.tooltip = System |
| 685 |
SystemApplicationComponentDiagramCommande.image = res/bmp/profile/system16.png |
| 686 |
TogafSystemFederationDiagramCommande.label = System Federation |
| 687 |
TogafSystemFederationDiagramCommande.tooltip = System Federation |
| 688 |
TogafSystemFederationDiagramCommande.image = res/bmp/profile/systemfederation16.png |
| 689 |
TogafEnterpriseSystemDiagramCommande.label = Enterprise System |
| 690 |
TogafEnterpriseSystemDiagramCommande.tooltip = Enterprise System |
| 691 |
TogafEnterpriseSystemDiagramCommande.image = res/bmp/profile/enterprisesystem16.png |
| 692 |
TogafApplicationDiagramCommande.label = Application |
| 693 |
TogafApplicationDiagramCommande.tooltip = Application |
| 694 |
TogafApplicationDiagramCommande.image = res/bmp/profile/application16.png |
| 695 |
ServiceApplicationComponentDiagramCommande.label = Service Component |
| 696 |
ServiceApplicationComponentDiagramCommande.tooltip = Service Component |
| 697 |
ServiceApplicationComponentDiagramCommande.image = res/bmp/profile/applicationcomponent16.png |
| 698 |
InteractionApplicationComponentDiagramCommande.label = Interaction Component |
| 699 |
InteractionApplicationComponentDiagramCommande.tooltip = Interaction Component |
| 700 |
InteractionApplicationComponentDiagramCommande.image = res/bmp/profile/interactioncomponent16.png |
| 701 |
ProcessApplicationComponentDiagramCommande.label = Process Component |
| 702 |
ProcessApplicationComponentDiagramCommande.tooltip = Process Component |
| 703 |
ProcessApplicationComponentDiagramCommande.image = res/bmp/profile/processcomponent16.png |
| 704 |
IntermediaryApplicationComponentDiagramCommande.label = Intermediary Component |
| 705 |
IntermediaryApplicationComponentDiagramCommande.tooltip = Intermediary Component |
| 706 |
IntermediaryApplicationComponentDiagramCommande.image = res/bmp/profile/intermediarycomponent16.png |
| 707 |
PublicApplicationComponentDiagramCommande.label = Public Component |
| 708 |
PublicApplicationComponentDiagramCommande.tooltip = Public Component |
| 709 |
PublicApplicationComponentDiagramCommande.image = res/bmp/profile/publiccomponent16.png |
| 710 |
UtilityApplicationComponentDiagramCommande.label = Utility Component |
| 711 |
UtilityApplicationComponentDiagramCommande.tooltip = Utility Component |
| 712 |
UtilityApplicationComponentDiagramCommande.image = res/bmp/profile/utilitycomponent16.png |
| 713 |
EntityApplicationComponentDiagramCommande.label = Entity Component |
| 714 |
EntityApplicationComponentDiagramCommande.tooltip = Entity Component |
| 715 |
EntityApplicationComponentDiagramCommande.image = res/bmp/profile/entitycomponent16.png |
| 716 |
DataBaseApplicationComponentDiagramCommande.label = Database |
| 717 |
DataBaseApplicationComponentDiagramCommande.tooltip = Database |
| 718 |
DataBaseApplicationComponentDiagramCommande.image = res/bmp/profile/databaseapplicationcomponent16.png |
| 719 |
TogafApplicationCollaborationDiagramCommande.label = Application Collaboration |
| 720 |
TogafApplicationCollaborationDiagramCommande.tooltip = Application Collaboration |
| 721 |
TogafApplicationCollaborationDiagramCommande.image = res/bmp/profile/applicationcollaboration16.png |
| 722 |
ProvidedServiceAccessDiagramCommande.label = Provided |
| 723 |
ProvidedServiceAccessDiagramCommande.tooltip = Provided |
| 724 |
ProvidedServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessprovide16.png |
| 725 |
RequiredServiceAccessDiagramCommande.label = Required |
| 726 |
RequiredServiceAccessDiagramCommande.tooltip = Required |
| 727 |
RequiredServiceAccessDiagramCommande.image = res/bmp/profile/serviceaccessrequired16.png |
| 728 |
TogafISServiceDiagramCommande.label = IS Service |
| 729 |
TogafISServiceDiagramCommande.tooltip = IS Service |
| 730 |
TogafISServiceDiagramCommande.image = res/bmp/profile/isservice16.png |
| 731 |
TogafISServiceOperationDiagramCommande.label = IS Service Operation |
| 732 |
TogafISServiceOperationDiagramCommande.tooltip = IS Service Operation |
| 733 |
TogafISServiceOperationDiagramCommande.image = res/bmp/profile/isserviceoperation16.png |
| 734 |
ApplicationComponentOperationDiagramCommande.label = Application Operation |
| 735 |
ApplicationComponentOperationDiagramCommande.tooltip = Application Operation |
| 736 |
ApplicationComponentOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png |
| 737 |
TogafApplicationComponentInstanceDiagramCommande.label = Application Instance |
| 738 |
TogafApplicationComponentInstanceDiagramCommande.tooltip = Application Instance |
| 739 |
TogafApplicationComponentInstanceDiagramCommande.image = res/bmp/profile/applicationcomponentinstance16.png |
| 740 |
MessageDiagramCommande.label = Message |
| 741 |
MessageDiagramCommande.tooltip = Message |
| 742 |
MessageDiagramCommande.image = res/bmp/profile/servicedata16.png |
| 743 |
ServiceDataFragmentDiagramCommande.label = Message Fragment |
| 744 |
ServiceDataFragmentDiagramCommande.tooltip = Message Fragment |
| 745 |
ServiceDataFragmentDiagramCommande.image = res/bmp/profile/servicedatafragment16.png |
| 746 |
ApplicationArchitectureAttributeDiagramCommande.label = Application Attribute |
| 747 |
ApplicationArchitectureAttributeDiagramCommande.tooltip = Application Attribute |
| 748 |
ApplicationArchitectureAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png |
| 749 |
InformationDomainDiagramCommande.label = Information Domain |
| 750 |
InformationDomainDiagramCommande.tooltip = Information Domain |
| 751 |
InformationDomainDiagramCommande.image = res/bmp/profile/businessdomain16.png |
| 752 |
BusinessEntityDiagramCommande.label = Business Entity |
| 753 |
BusinessEntityDiagramCommande.tooltip = Business Entity |
| 754 |
BusinessEntityDiagramCommande.image = res/bmp/profile/businessentitys16.png |
| 755 |
BusinessOperationDiagramCommande.label = Operation |
| 756 |
BusinessOperationDiagramCommande.tooltip = Operation |
| 757 |
BusinessOperationDiagramCommande.image = res/bmp/profile/businessoperation16.png |
| 758 |
BusinessAttributeDiagramCommande.label = Attribute |
| 759 |
BusinessAttributeDiagramCommande.tooltip = Attribute |
| 760 |
BusinessAttributeDiagramCommande.image = res/bmp/profile/businessattribute16.png |
| 761 |
TogafEnumerationDiagramCommande.label = Enumeration |
| 762 |
TogafEnumerationDiagramCommande.tooltip = Enumeration |
| 763 |
TogafEnumerationDiagramCommande.image = res/bmp/profile/businessenumeration16.png |
| 764 |
UMLEnumerationLitteralDiagramCommande.label = Enumeration Literal |
| 765 |
UMLEnumerationLitteralDiagramCommande.tooltip = Enumeration Literal |
| 766 |
UMLEnumerationLitteralDiagramCommande.image = res/bmp/modelio/umlenumerationlitteral.png |
| 767 |
BusinessDataTypeDiagramCommande.label = Business Data Type |
| 768 |
BusinessDataTypeDiagramCommande.tooltip = Business Data Type |
| 769 |
BusinessDataTypeDiagramCommande.image = res/bmp/profile/businessdatatype16.png |
| 770 |
UMLPortDiagramCommande.label = Port |
| 771 |
UMLPortDiagramCommande.tooltip = Port |
| 772 |
UMLPortDiagramCommande.image = res/bmp/modelio/umlport.png |
| 773 |
TogafBusDiagramCommande.label = Bus |
| 774 |
TogafBusDiagramCommande.tooltip = Bus |
| 775 |
TogafBusDiagramCommande.image = res/bmp/profile/togafbus16.png |
| 776 |
ConnexionDiagramCommande.label = Connection |
| 777 |
ConnexionDiagramCommande.tooltip = Hardware Tecnology Component/Instance -> Hardware Tecnology Component/Instance |
| 778 |
ConnexionDiagramCommande.image = res/bmp/profile/connexion16.png |
| 779 |
NetworkLinkDiagramCommande.label = Network Link |
| 780 |
NetworkLinkDiagramCommande.tooltip = Network Link : Technology Architecture Element/Technology Architecture Element |
| 781 |
NetworkLinkDiagramCommande.image = res/bmp/profile/togafnetworklink16.png |
| 782 |
TogafFunctionSequenceDiagramCommande.label = Sequence |
| 783 |
TogafFunctionSequenceDiagramCommande.tooltip = Function -> Function |
| 784 |
TogafFunctionSequenceDiagramCommande.image = res/bmp/profile/togaffunctionsequence16.png |
| 785 |
IOFlowDiagramCommande.label = Flow |
| 786 |
IOFlowDiagramCommande.tooltip = Any active element<-->Product/Entity/Event |
| 787 |
IOFlowDiagramCommande.image = res/bmp/profile/ioflow16.png |
| 788 |
AssumesDiagramCommande.label = Assumes |
| 789 |
AssumesDiagramCommande.tooltip = Actor -> Role |
| 790 |
AssumesDiagramCommande.image = res/bmp/profile/assumes16.png |
| 791 |
TogafConsumesDiagramCommande.label = Consumes |
| 792 |
TogafConsumesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Operation/Service/Component |
| 793 |
TogafConsumesDiagramCommande.image = res/bmp/profile/togafconsumes16.png |
| 794 |
InitiatorDiagramCommande.label = Initiator of |
| 795 |
InitiatorDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process |
| 796 |
InitiatorDiagramCommande.image = res/bmp/profile/initiator16.png |
| 797 |
ResponsibleDiagramCommande.label = Responsible of |
| 798 |
ResponsibleDiagramCommande.tooltip = Role/Actor -> Role/Actor/Organization Unit |
| 799 |
ResponsibleDiagramCommande.image = res/bmp/profile/responsible16.png |
| 800 |
ParticipatesDiagramCommande.label = Participates in |
| 801 |
ParticipatesDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service/Service Operation |
| 802 |
ParticipatesDiagramCommande.image = res/bmp/profile/participates16.png |
| 803 |
CommunicatesDiagramCommande.label = Communicates with |
| 804 |
CommunicatesDiagramCommande.tooltip = Role/Actor -> Role/Actor |
| 805 |
CommunicatesDiagramCommande.image = res/bmp/profile/communicates16.png |
| 806 |
OwnerDiagramCommande.label = Owner of |
| 807 |
OwnerDiagramCommande.tooltip = Role/Actor/Organization Unit -> Process/Service |
| 808 |
OwnerDiagramCommande.image = res/bmp/profile/owner16.png |
| 809 |
ContractOfDiagramCommand.label = Contract of |
| 810 |
ContractOfDiagramCommand.tooltip = Service -> Service Contract |
| 811 |
ContractOfDiagramCommand.image = res/bmp/profile/contractof16.png |
| 812 |
TogafParticipantDecomposition.label = Composed of |
| 813 |
TogafParticipantDecomposition.tooltip = Role/Actor -> Role/Actor |
| 814 |
TogafParticipantDecomposition.image = res/bmp/profile/participantdecomposition16.png |
| 815 |
ServiceProcessSupportDiagramCommande.label = Supports |
| 816 |
ServiceProcessSupportDiagramCommande.tooltip = Service/Service Access/Process/Component -> Service/Process |
| 817 |
ServiceProcessSupportDiagramCommande.image = res/bmp/profile/serviceprocesssupport16.png |
| 818 |
PartDiagramCommande.label = Part |
| 819 |
PartDiagramCommande.tooltip = Function <--> Function |
| 820 |
PartDiagramCommande.image = res/bmp/profile/part16.png |
| 821 |
TogafLocalizationDiagramCommande.label = Localization |
| 822 |
TogafLocalizationDiagramCommande.tooltip = Role/Actor/Organization Unit -> Location |
| 823 |
TogafLocalizationDiagramCommande.image = res/bmp/profile/togaflocalization16.png |
| 824 |
TogafParticipantAllocationDiagramCommande.label = Allocated |
| 825 |
TogafParticipantAllocationDiagramCommande.tooltip = Role/Actor -> Organization Unit |
| 826 |
TogafParticipantAllocationDiagramCommande.image = res/bmp/profile/togafparticipantallocation16.png |
| 827 |
ComponentRealizationDiagramCommande.label = Component Realization |
| 828 |
ComponentRealizationDiagramCommande.tooltip = Component -> Service/Process/Use Case |
| 829 |
ComponentRealizationDiagramCommande.image = res/bmp/profile/componentrealizationinitiator16.png |
| 830 |
MigrationDiagramCommand.label = Migrate |
| 831 |
MigrationDiagramCommand.tooltip = Migrate |
| 832 |
MigrationDiagramCommand.image = res/bmp/profile/migration.png |
| 833 |
UMLInformationFLowDiagramCommand.label = Information Flow |
| 834 |
UMLInformationFLowDiagramCommand.tooltip = Information Flow |
| 835 |
UMLInformationFLowDiagramCommand.image = res/bmp/modelio/umlinformationflow.png |
| 836 |
|
| 837 |
|
| 838 |
|
| 839 |
TogafClassDiagramWizardContributor.label = Class diagram |
| 840 |
TogafClassDiagramWizardContributor.icon = res/bmp/profile/classdiagram16.png |
| 841 |
TogafClassDiagramWizardContributor.info = Class diagram |
| 842 |
TogafClassDiagramWizardContributor.detail = The key purpose of the Class diagram is to depict the relationships among the critical data entities (or classes) within the enterprise. |
| 843 |
TogafClassDiagramWizardContributor.preview = res/bmp/profile/classdiagrampreview.png |
| 844 |
TogafClassHierachyDiagramWizardContributor.label = Class Hierarchy diagram |
| 845 |
TogafClassHierachyDiagramWizardContributor.icon = res/bmp/profile/classhierachydiagram16.png |
| 846 |
TogafClassHierachyDiagramWizardContributor.info = Class Hierarchy diagram |
| 847 |
TogafClassHierachyDiagramWizardContributor.detail = The purpose of the Class Hierarchy diagram is to show the technical stakeholders a perspective of the class hierarchy. |
| 848 |
TogafClassHierachyDiagramWizardContributor.preview = res/bmp/profile/classhierachydiagrampreview.png |
| 849 |
TogafDataLifeCycleDiagramWizardContributor.label = Data Lifecycle diagram |
| 850 |
TogafDataLifeCycleDiagramWizardContributor.icon = res/bmp/profile/togafdatalifecyclediagram16.png |
| 851 |
TogafDataLifeCycleDiagramWizardContributor.info = Data Lifecycle diagram |
| 852 |
TogafDataLifeCycleDiagramWizardContributor.detail = The Entity Lifecycle diagram is an essential part of managing business entities throughout its lifecycle from conception until disposal within the constraints of the business process. |
| 853 |
TogafDataLifeCycleDiagramWizardContributor.preview = res/bmp/profile/togafdatalifecyclediagrampreview.png |
| 854 |
TogafApplicationAndUserLocationDiagramWizardContributor.label = Application and User Location diagram |
| 855 |
TogafApplicationAndUserLocationDiagramWizardContributor.icon = res/bmp/profile/togafapplicationanduserlocationdiagram16.png |
| 856 |
TogafApplicationAndUserLocationDiagramWizardContributor.info = Application and User Location diagram |
| 857 |
TogafApplicationAndUserLocationDiagramWizardContributor.detail = The application and user location diagram shows the geographical distribution of applications. |
| 858 |
TogafApplicationAndUserLocationDiagramWizardContributor.preview = res/bmp/profile/togafapplicationanduserlocationdiagrampreview.png |
| 859 |
TogafDataMigrationDiagramWizardContributor.label = Data Migration diagram |
| 860 |
TogafDataMigrationDiagramWizardContributor.icon = res/bmp/profile/datamigrationdiagram16.png |
| 861 |
TogafDataMigrationDiagramWizardContributor.info = Data Migration diagram |
| 862 |
TogafDataMigrationDiagramWizardContributor.detail = The purpose of the Data Migration diagram is to show the flow of data from the source to the target applications. |
| 863 |
TogafDataMigrationDiagramWizardContributor.preview = res/bmp/profile/datamigrationdiagrampreview.png |
| 864 |
TogafBusinessFootPrintDiagramWizardContributor.label = Business Footprint diagram |
| 865 |
TogafBusinessFootPrintDiagramWizardContributor.icon = res/bmp/profile/businessfootprintdiagram16.png |
| 866 |
TogafBusinessFootPrintDiagramWizardContributor.info = Business Footprint diagram |
| 867 |
TogafBusinessFootPrintDiagramWizardContributor.detail = A Business Footprint diagram describes the links between business goals, organizational units, business functions, and services, and maps these functions to the technical components delivering the required capability. |
| 868 |
TogafBusinessFootPrintDiagramWizardContributor.preview = res/bmp/profile/businessfootprintdiagrampreview.png |
| 869 |
TogafApplicationCommunicationDiagramWizardContributor.label = Application Communication diagram |
| 870 |
TogafApplicationCommunicationDiagramWizardContributor.icon = res/bmp/profile/applicationcommunicationdiagram16.png |
| 871 |
TogafApplicationCommunicationDiagramWizardContributor.info = Application Communication diagram |
| 872 |
TogafApplicationCommunicationDiagramWizardContributor.detail = The purpose of the Application Communication diagram is to depict all models and mappings related to communication between applications in the metamodel entity. |
| 873 |
TogafApplicationCommunicationDiagramWizardContributor.preview = res/bmp/profile/applicationcommunicationdiagrampreview.png |
| 874 |
TogafSystemUseCaseDiagramWizardContributor.label = System Use Case diagram |
| 875 |
TogafSystemUseCaseDiagramWizardContributor.icon = res/bmp/profile/togafsystemusecasediagram16.png |
| 876 |
TogafSystemUseCaseDiagramWizardContributor.info = System Use Case diagram |
| 877 |
TogafSystemUseCaseDiagramWizardContributor.detail = A Use-Case diagram displays the relationships between consumers and providers of Services. |
| 878 |
TogafSystemUseCaseDiagramWizardContributor.preview = res/bmp/profile/togafsystemusecasediagrampreview.png |
| 879 |
TogafApplicationMigrationDiagramWizardContributor.label = Application Migration diagram |
| 880 |
TogafApplicationMigrationDiagramWizardContributor.icon = res/bmp/profile/togafapplicationmigrationdiagram16.png |
| 881 |
TogafApplicationMigrationDiagramWizardContributor.info = Application Migration diagram |
| 882 |
TogafApplicationMigrationDiagramWizardContributor.detail = The Application Migration diagram identifies application migration from baseline to target application components. |
| 883 |
TogafApplicationMigrationDiagramWizardContributor.preview = res/bmp/profile/togafapplicationmigrationdiagrampreview.png |
| 884 |
TogafDataDisseminationDiagramWizardContributor.label = Data Dissemination diagram |
| 885 |
TogafDataDisseminationDiagramWizardContributor.icon = res/bmp/profile/togafdatadisseminationdiagram16.png |
| 886 |
TogafDataDisseminationDiagramWizardContributor.info = Data Dissemination diagram |
| 887 |
TogafDataDisseminationDiagramWizardContributor.detail = The purpose of the Data Dissemination diagram is to show the relationship between data entities, business services, and application components. |
| 888 |
TogafDataDisseminationDiagramWizardContributor.preview = res/bmp/profile/togafdatadisseminationdiagrampreview.png |
| 889 |
TogafEnterpriseManageabilityDiagramWizardContributor.label = Enterprise Manageability diagram |
| 890 |
TogafEnterpriseManageabilityDiagramWizardContributor.icon = res/bmp/profile/togafenterprisemanageabilitydiagram16.png |
| 891 |
TogafEnterpriseManageabilityDiagramWizardContributor.info = Enterprise Manageability diagram |
| 892 |
TogafEnterpriseManageabilityDiagramWizardContributor.detail = The Enterprise Manageability diagram shows how one or more applications interact with application and technology components that support operational management of a solution. |
| 893 |
TogafEnterpriseManageabilityDiagramWizardContributor.preview = res/bmp/profile/togafenterprisemanageabilitydiagrampreview.png |
| 894 |
TogafProcessSystemRealizationDiagramWizardContributor.label = Process System Realization diagram |
| 895 |
TogafProcessSystemRealizationDiagramWizardContributor.icon = res/bmp/profile/togafprocesssystemrealizationdiagram16.png |
| 896 |
TogafProcessSystemRealizationDiagramWizardContributor.info = Process System Realization diagram |
| 897 |
TogafProcessSystemRealizationDiagramWizardContributor.detail = The purpose of the Process/System Realization diagram is to clearly depict the sequence of events when multiple applications are involved in executing a business process. |
| 898 |
TogafProcessSystemRealizationDiagramWizardContributor.preview = res/bmp/profile/togafprocesssystemrealizationdiagrampreview.png |
| 899 |
TogafProjectContextDiagramWizardContributor.label = Project Context diagram |
| 900 |
TogafProjectContextDiagramWizardContributor.icon = res/bmp/profile/togafprojectcontextdiagram16.png |
| 901 |
TogafProjectContextDiagramWizardContributor.info = Project Context diagram |
| 902 |
TogafProjectContextDiagramWizardContributor.detail = A Project Context diagram shows the scope of a work package to be implemented as a part of a broader transformation roadmap. |
| 903 |
TogafProjectContextDiagramWizardContributor.preview = res/bmp/profile/togafprojectcontextdiagrampreview.png |
| 904 |
TogafSolutionConceptDiagramWizardContributor.label = Solution Concept diagram |
| 905 |
TogafSolutionConceptDiagramWizardContributor.icon = res/bmp/profile/togafsolutionconceptdiagram16.png |
| 906 |
TogafSolutionConceptDiagramWizardContributor.info = Solution Concept diagram |
| 907 |
TogafSolutionConceptDiagramWizardContributor.detail = A Solution Concept diagram provides a high-level orientation of the solution that is envisaged in order to meet the objectives of the architecture engagement. |
| 908 |
TogafSolutionConceptDiagramWizardContributor.preview = res/bmp/profile/togafsolutionconceptdiagrampreview.png |
| 909 |
TogafBenefitsDiagramWizardContributor.label = Benefits diagram |
| 910 |
TogafBenefitsDiagramWizardContributor.icon = res/bmp/profile/togafbenefitsdiagram16.png |
| 911 |
TogafBenefitsDiagramWizardContributor.info = Benefits diagram |
| 912 |
TogafBenefitsDiagramWizardContributor.detail = The Benefits diagram shows opportunities identified in an architecture definition, classified according to their relative size, benefit, and complexity. |
| 913 |
TogafBenefitsDiagramWizardContributor.preview = res/bmp/profile/togafbenefitsdiagrampreview.png |
| 914 |
TogafBusinessServiceInformationDiagramWizardContributor.label = Business Service Information diagram |
| 915 |
TogafBusinessServiceInformationDiagramWizardContributor.icon = res/bmp/profile/businessserviceinformationdiagram16.png |
| 916 |
TogafBusinessServiceInformationDiagramWizardContributor.info = Business Service Information diagram |
| 917 |
TogafBusinessServiceInformationDiagramWizardContributor.detail = The Business Service/Information diagram shows the information needed to support one or more business services. |
| 918 |
TogafBusinessServiceInformationDiagramWizardContributor.preview = res/bmp/profile/businessserviceinformationdiagrampreview.png |
| 919 |
TogafUseCaseDiagramWizardContributor.label = Use Case diagram |
| 920 |
TogafUseCaseDiagramWizardContributor.icon = res/bmp/profile/togafusecasediagram16.png |
| 921 |
TogafUseCaseDiagramWizardContributor.info = Use Case diagram |
| 922 |
TogafUseCaseDiagramWizardContributor.detail = A Use-Case diagram displays the relationships between consumers and providers of Services. |
| 923 |
TogafUseCaseDiagramWizardContributor.preview = res/bmp/profile/togafusecasediagrampreview.png |
| 924 |
ServiceDataDiagramWizardContributor.label = Logical Data diagram |
| 925 |
ServiceDataDiagramWizardContributor.icon = res/bmp/profile/servicedatadiagram16.png |
| 926 |
ServiceDataDiagramWizardContributor.info = Logical Data diagram |
| 927 |
ServiceDataDiagramWizardContributor.detail = Messages need a dedicated model and definition. |
| 928 |
ServiceDataDiagramWizardContributor.preview = res/bmp/profile/servicedatadiagrampreview.png |
| 929 |
SoftwareEngineeringDiagramWizardContributor.label = Software Engineering diagram |
| 930 |
SoftwareEngineeringDiagramWizardContributor.icon = res/bmp/modelio/softwareengineering16.png |
| 931 |
SoftwareEngineeringDiagramWizardContributor.info = Software Engineering diagram |
| 932 |
SoftwareEngineeringDiagramWizardContributor.detail = The purpose of Software Engineering diagrams is to define TOGAF Software Engineering |
| 933 |
SoftwareDistributionDiagramWizardContributor.label = Software Distribution diagram |
| 934 |
SoftwareDistributionDiagramWizardContributor.icon = res/bmp/modelio/softwaredistribution16.png |
| 935 |
SoftwareDistributionDiagramWizardContributor.info = Software Distribution diagram |
| 936 |
SoftwareDistributionDiagramWizardContributor.detail = The Software Distribution diagram shows how application software is structured and distributed across the estate. |
| 937 |
SoftwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png |
| 938 |
TogafProcessFlowDiagramWizardContributor.label = Process Flow diagram |
| 939 |
TogafProcessFlowDiagramWizardContributor.icon = res/bmp/profile/processflowdiagram16.png |
| 940 |
TogafProcessFlowDiagramWizardContributor.info = Process Flow diagram |
| 941 |
TogafProcessFlowDiagramWizardContributor.detail = Business Process modeling is done using business process diagrams.\nThe purpose of the business process diagram is to depict all models and mappings related to a process. |
| 942 |
TogafProcessFlowDiagramWizardContributor.preview = res/bmp/profile/processflowdiagrampreview.png |
| 943 |
TogafFunctionalDecompositionDiagramWizardContributor.label = Functional Decomposition diagram |
| 944 |
TogafFunctionalDecompositionDiagramWizardContributor.icon = res/bmp/profile/functionaldecompositiondiagram16.png |
| 945 |
TogafFunctionalDecompositionDiagramWizardContributor.info = Togaf Functional Decomposition diagram |
| 946 |
TogafFunctionalDecompositionDiagramWizardContributor.detail = The purpose of the Functional Decomposition diagram is to show on a single page the capabilities of an organization that are relevant to the consideration of an architecture. |
| 947 |
TogafFunctionalDecompositionDiagramWizardContributor.preview = res/bmp/profile/functionaldecompositiondiagrampreview.png |
| 948 |
TogafProductLifeCycleDiagramWizardContributor.label = Product Lifecycle diagram |
| 949 |
TogafProductLifeCycleDiagramWizardContributor.icon = res/bmp/profile/productlifecyclediagram16.png |
| 950 |
TogafProductLifeCycleDiagramWizardContributor.info = Product Lifecycle diagram |
| 951 |
TogafProductLifeCycleDiagramWizardContributor.detail = The purpose of the Product Lifecycle diagram is to assist in understanding the lifecycles of key entities within the enterprise. |
| 952 |
TogafProductLifeCycleDiagramWizardContributor.preview = res/bmp/profile/productlifecyclediagrampreview.png |
| 953 |
TogafGoalObjectiveServiceDiagramWizardContributor.label = Driver/Goal/Objectives diagram |
| 954 |
TogafGoalObjectiveServiceDiagramWizardContributor.icon = res/bmp/profile/goalobjectiveservicediagram16.png |
| 955 |
TogafGoalObjectiveServiceDiagramWizardContributor.info = Driver/Goal/Objectives diagram |
| 956 |
TogafGoalObjectiveServiceDiagramWizardContributor.detail = The purpose of a Goal/Objective/Service diagram is to define the ways in which a service contributes to the achievement of a business vision or strategy. |
| 957 |
TogafGoalObjectiveServiceDiagramWizardContributor.preview = res/bmp/profile/goalobjectiveservicediagrampreview.png |
| 958 |
TogafBusinessUseCaseDiagramWizardContributor.label = Business Use Case diagram |
| 959 |
TogafBusinessUseCaseDiagramWizardContributor.icon = res/bmp/profile/togafusecasediagram16.png |
| 960 |
TogafBusinessUseCaseDiagramWizardContributor.info = Business Use Case diagram |
| 961 |
TogafBusinessUseCaseDiagramWizardContributor.detail = A Business Use-Case diagram displays the relationships between consumers and providers of business services. |
| 962 |
TogafBusinessUseCaseDiagramWizardContributor.preview = res/bmp/profile/togafusecasediagrampreview.png |
| 963 |
TogafOrganizationRoleDiagramWizardContributor.label = Organization Role diagram |
| 964 |
TogafOrganizationRoleDiagramWizardContributor.icon = res/bmp/profile/organizationrolediagram16.png |
| 965 |
TogafOrganizationRoleDiagramWizardContributor.info = Organization Role diagram |
| 966 |
TogafOrganizationRoleDiagramWizardContributor.detail = Diagram dedicated to the definition of participants and their responsibilities. Roles and actors are modeled here. |
| 967 |
TogafOrganizationRoleDiagramWizardContributor.preview = res/bmp/profile/organizationrolediagrampreview.png |
| 968 |
TogafOrganizationDecompositionDiagramWizardContributor.label = Organization Decomposition diagram |
| 969 |
TogafOrganizationDecompositionDiagramWizardContributor.icon = res/bmp/profile/organizationdecompositiondiagram16.png |
| 970 |
TogafOrganizationDecompositionDiagramWizardContributor.info = Organization Decomposition diagram |
| 971 |
TogafOrganizationDecompositionDiagramWizardContributor.detail = An Organization diagram describes the links between actors, and locations within an organization tree. |
| 972 |
TogafOrganizationDecompositionDiagramWizardContributor.preview = res/bmp/profile/organizationdecompositiondiagrampreview.png |
| 973 |
TogafEventDiagramWizardContributor.label = Event diagram |
| 974 |
TogafEventDiagramWizardContributor.icon = res/bmp/profile/togafeventdiagram16.png |
| 975 |
TogafEventDiagramWizardContributor.info = Event diagram |
| 976 |
TogafEventDiagramWizardContributor.detail = The purpose of the process map diagram is to depict the relationship between events and process, and to show an overview of the business processes. |
| 977 |
TogafEventDiagramWizardContributor.preview = res/bmp/profile/togafeventdiagrampreview.png |
| 978 |
TogafDataSecurityDiagramWizardContributor.label = Data Security diagram |
| 979 |
TogafDataSecurityDiagramWizardContributor.icon = res/bmp/profile/togafdatasecuritydiagram16.png |
| 980 |
TogafDataSecurityDiagramWizardContributor.info = Data Security diagram |
| 981 |
TogafDataSecurityDiagramWizardContributor.detail = Data is considered as an asset to the enterprise and data security simply means ensuring that enterprise data is not compromised and that access to it is suitably controlled. |
| 982 |
TogafDataSecurityDiagramWizardContributor.preview = res/bmp/profile/togafdatasecuritydiagrampreview.png |
| 983 |
TogafValueChainDiagramWizardContributor.label = Value Chain diagram |
| 984 |
TogafValueChainDiagramWizardContributor.icon = res/bmp/profile/togafvaluechaindiagram16.png |
| 985 |
TogafValueChainDiagramWizardContributor.info = Value Chain diagram |
| 986 |
TogafValueChainDiagramWizardContributor.detail = A Value Chain diagram provides a high-level orientation view of an enterprise and how it interacts with the outside world. |
| 987 |
TogafValueChainDiagramWizardContributor.preview = res/bmp/profile/togafvaluechaindiagrampreview.png |
| 988 |
TogafLocationDiagramWizardContributor.label = Location diagram |
| 989 |
TogafLocationDiagramWizardContributor.icon = res/bmp/profile/togaflocationdiagram16.png |
| 990 |
TogafLocationDiagramWizardContributor.info = Location diagram |
| 991 |
TogafLocationDiagramWizardContributor.detail = This kind of diagram helps in formalizing the locations of an enterprise, and the distribution of platforms and business services on it. |
| 992 |
TogafLocationDiagramWizardContributor.preview = res/bmp/profile/togaflocationdiagrampreview.png |
| 993 |
TogafEnvironmentAndLocationsDiagramWizardContributor.label = Environment and Locations diagram |
| 994 |
TogafEnvironmentAndLocationsDiagramWizardContributor.icon = res/bmp/profile/togafenvironmentandlocationsdiagram16.png |
| 995 |
TogafEnvironmentAndLocationsDiagramWizardContributor.info = Environment and Locations diagram |
| 996 |
TogafEnvironmentAndLocationsDiagramWizardContributor.detail = Environments and Locations diagram depicts which locations host which applications, identifies what technologies and/or applications are used at which locations, and finally identifies the locations from which business users typically interact with the applications. |
| 997 |
TogafEnvironmentAndLocationsDiagramWizardContributor.preview = res/bmp/profile/togafenvironmentandlocationsdiagrampreview.png |
| 998 |
TogafNewtorkComputingHardwareDiagramWizardContributor.label = Network Computing Hardware diagram |
| 999 |
TogafNewtorkComputingHardwareDiagramWizardContributor.icon = res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png |
| 1000 |
TogafNewtorkComputingHardwareDiagramWizardContributor.info = Network Computing Hardware diagram |
| 1001 |
TogafNewtorkComputingHardwareDiagramWizardContributor.detail = Representation of the deployment of service components to computing devices (i.e. servers, workstations, \u2026). |
| 1002 |
TogafNewtorkComputingHardwareDiagramWizardContributor.preview = res/bmp/profile/togafnewtorkcomputinghardwarediagrampreview.png |
| 1003 |
TogafPlatformDecompositionDiagramWizardContributor.label = Platform decomposition diagram |
| 1004 |
TogafPlatformDecompositionDiagramWizardContributor.icon = res/bmp/profile/togafplatformdecompositiondiagram16.png |
| 1005 |
TogafPlatformDecompositionDiagramWizardContributor.info = Platform Decomposition diagram |
| 1006 |
TogafPlatformDecompositionDiagramWizardContributor.detail = The Platform Decomposition diagram depicts the technology platform that supports the operations of the Information Systems Architecture. |
| 1007 |
TogafPlatformDecompositionDiagramWizardContributor.preview = res/bmp/profile/togafplatformdecompositiondiagrampreview.png |
| 1008 |
TogafProcessingDiagramWizardContributor.label = Processing diagram |
| 1009 |
TogafProcessingDiagramWizardContributor.icon = res/bmp/profile/togafprocessingdiagram16.png |
| 1010 |
TogafProcessingDiagramWizardContributor.info = Processing diagram |
| 1011 |
TogafProcessingDiagramWizardContributor.detail = The Software Distribution diagram shows how application software is structured and distributed across the estate. |
| 1012 |
TogafProcessingDiagramWizardContributor.preview = res/bmp/profile/togafprocessingdiagrampreview.png |
| 1013 |
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram |
| 1014 |
TogafCommunicationEngineeringDiagramsCommande.icon = res/bmp/profile/togafcommunicationengineeringdiagrams16.png |
| 1015 |
TogafCommunicationEngineeringDiagramsCommande.info = Communication Engineering diagram |
| 1016 |
TogafCommunicationEngineeringDiagramsCommande.detail = The Communications Engineering diagram describes the means of communication, the method of sending and receiving information between these assets in the Technology Architecture; insofar as the selection of package solutions in the preceding architectures put specific requirements on the communications between the applications. |
| 1017 |
TogafCommunicationEngineeringDiagramsCommande.preview = res/bmp/profile/togafcommunicationengineeringdiagramspreview.png |
| 1018 |
TogafSofwareDistributionDiagramWizardContributor.label = Software Distribution diagram |
| 1019 |
TogafSofwareDistributionDiagramWizardContributor.icon = res/bmp/profile/sofwaredistributiondiagram16.png |
| 1020 |
TogafSofwareDistributionDiagramWizardContributor.info = Software Distribution diagram |
| 1021 |
TogafSofwareDistributionDiagramWizardContributor.detail = The Software Distribution diagram shows how application software is structured and distributed across the estate. |
| 1022 |
TogafSofwareDistributionDiagramWizardContributor.preview = res/bmp/profile/softwaredistributionpreview.png |
| 1023 |
TogafMatrixDiagramWizardContributor.label = Traceability diagram |
| 1024 |
TogafMatrixDiagramWizardContributor.icon = res/bmp/profile/togafmatrixdiagram16.png |
| 1025 |
TogafMatrixDiagramWizardContributor.info = Traceability diagram |
| 1026 |
TogafMatrixDiagramWizardContributor.detail = The purpose of Matrix diagrams is to define dependencies that will produce the Excell Matrices. Matrix diagrams are also useful to define general purpose traceabilities between elements. |
| 1027 |
TogafMatrixDiagramWizardContributor.preview = res/bmp/profile/togafmatrixdiagrampreview.png |
| 1028 |
|
| 1029 |
|
| 1030 |
TogafClassDiagramCommand.label = Class diagram |
| 1031 |
TogafClassDiagramCommand.tooltip = Class diagram |
| 1032 |
TogafClassDiagramCommand.image = res/bmp/profile/classdiagram16.png |
| 1033 |
TogafClassHierachyDiagramCommand.label = Class Hierarchy diagram |
| 1034 |
TogafClassHierachyDiagramCommand.tooltip = Class Hierarchy diagram |
| 1035 |
TogafClassHierachyDiagramCommand.image = res/bmp/profile/classhierachydiagram16.png |
| 1036 |
TogafDataLifeCycleDiagramCommand.label = Data Lifecycle diagram |
| 1037 |
TogafDataLifeCycleDiagramCommand.tooltip = Data Lifecycle diagram |
| 1038 |
TogafDataLifeCycleDiagramCommand.image = res/bmp/profile/togafdatalifecyclediagram16.png |
| 1039 |
TogafApplicationAndUserLocationDiagramCommande.label = Application and User Location diagram |
| 1040 |
TogafApplicationAndUserLocationDiagramCommande.tooltip = Application and User Location diagram |
| 1041 |
TogafApplicationAndUserLocationDiagramCommande.image = res/bmp/profile/togafapplicationanduserlocationdiagram16.png |
| 1042 |
TogafDataMigrationDiagramCommand.label = Data Migration diagram |
| 1043 |
TogafDataMigrationDiagramCommand.tooltip = Data Migration diagram |
| 1044 |
TogafDataMigrationDiagramCommand.image = res/bmp/profile/datamigrationdiagram16.png |
| 1045 |
TogafBusinessFootPrintDiagramCommande.label = Business Footprint diagram |
| 1046 |
TogafBusinessFootPrintDiagramCommande.tooltip = Business Footprint diagram |
| 1047 |
TogafBusinessFootPrintDiagramCommande.image = res/bmp/profile/businessfootprintdiagram16.png |
| 1048 |
TogafApplicationCommunicationDiagramCommande.label = Application Communication diagram |
| 1049 |
TogafApplicationCommunicationDiagramCommande.tooltip = Application Communication diagram |
| 1050 |
TogafApplicationCommunicationDiagramCommande.image = res/bmp/profile/applicationcommunicationdiagram16.png |
| 1051 |
TogafSystemUseCaseDiagramCommande.label = System Use Case diagram |
| 1052 |
TogafSystemUseCaseDiagramCommande.tooltip = System Use Case diagram |
| 1053 |
TogafSystemUseCaseDiagramCommande.image = res/bmp/profile/togafsystemusecasediagram16.png |
| 1054 |
TogafApplicationMigrationDiagramCommande.label = Application Migration diagram |
| 1055 |
TogafApplicationMigrationDiagramCommande.tooltip = Application Migration diagram |
| 1056 |
TogafApplicationMigrationDiagramCommande.image = res/bmp/profile/togafapplicationmigrationdiagram16.png |
| 1057 |
TogafDataDisseminationDiagramCommande.label = Data Dissemination diagram |
| 1058 |
TogafDataDisseminationDiagramCommande.tooltip = Data Dissemination diagram |
| 1059 |
TogafDataDisseminationDiagramCommande.image = res/bmp/profile/togafdatadisseminationdiagram16.png |
| 1060 |
TogafEnterpriseManageabilityDiagramCommande.label = Enterprise Manageability diagram |
| 1061 |
TogafEnterpriseManageabilityDiagramCommande.tooltip = Enterprise Manageability diagram |
| 1062 |
TogafEnterpriseManageabilityDiagramCommande.image = res/bmp/profile/togafenterprisemanageabilitydiagram16.png |
| 1063 |
TogafProcessSystemRealizationDiagramCommande.label = Process System Realization diagram |
| 1064 |
TogafProcessSystemRealizationDiagramCommande.tooltip = Process System Realization diagram |
| 1065 |
TogafProcessSystemRealizationDiagramCommande.image = res/bmp/profile/togafprocesssystemrealizationdiagram16.png |
| 1066 |
TogafProjectContextDiagramCommande.label = Project Context diagram |
| 1067 |
TogafProjectContextDiagramCommande.tooltip = Project Context diagram |
| 1068 |
TogafProjectContextDiagramCommande.image = res/bmp/profile/togafprojectcontextdiagram16.png |
| 1069 |
TogafSolutionConceptDiagramCommande.label = Solution Concept diagram |
| 1070 |
TogafSolutionConceptDiagramCommande.tooltip = Solution Concept diagram |
| 1071 |
TogafSolutionConceptDiagramCommande.image = res/bmp/profile/togafsolutionconceptdiagram16.png |
| 1072 |
TogafBenefitsDiagramCommande.label = Benefits diagram |
| 1073 |
TogafBenefitsDiagramCommande.tooltip = Benefits diagram |
| 1074 |
TogafBenefitsDiagramCommande.image = res/bmp/profile/togafbenefitsdiagram16.png |
| 1075 |
TogafBusinessServiceInformationDiagramCommande.label = Business Service Information diagram |
| 1076 |
TogafBusinessServiceInformationDiagramCommande.tooltip = Business Service Information diagram |
| 1077 |
TogafBusinessServiceInformationDiagramCommande.image = res/bmp/profile/businessserviceinformationdiagram16.png |
| 1078 |
TogafUseCaseDiagramCommande.label = Use Case diagram |
| 1079 |
TogafUseCaseDiagramCommande.tooltip = Use Case diagram |
| 1080 |
TogafUseCaseDiagramCommande.image = res/bmp/profile/togafusecasediagram16.png |
| 1081 |
ServiceDataDiagramCommande.label = Logical Data diagram |
| 1082 |
ServiceDataDiagramCommande.tooltip = Logical Data diagram |
| 1083 |
ServiceDataDiagramCommande.image = res/bmp/profile/servicedatadiagram16.png |
| 1084 |
SoftwareEngineeringDiagramCommande.label = Software Engineering diagram |
| 1085 |
SoftwareEngineeringDiagramCommande.tooltip = Software Engineering diagram |
| 1086 |
SoftwareEngineeringDiagramCommande.image = res/bmp/modelio/softwareengineering16.png |
| 1087 |
SoftwareDistributionDiagramCommande.label = Software Distribution diagram |
| 1088 |
SoftwareDistributionDiagramCommande.tooltip = Software Distribution diagram |
| 1089 |
SoftwareDistributionDiagramCommande.image = res/bmp/modelio/softwaredistribution16.png |
| 1090 |
TogafProcessFlowDiagramCommande.label = Process Flow diagram |
| 1091 |
TogafProcessFlowDiagramCommande.tooltip = Process Flow diagram |
| 1092 |
TogafProcessFlowDiagramCommande.image = res/bmp/profile/processflowdiagram16.png |
| 1093 |
TogafFunctionalDecompositionDiagramCommande.label = Functional Decomposition diagram |
| 1094 |
TogafFunctionalDecompositionDiagramCommande.tooltip = Togaf Functional Decomposition diagram |
| 1095 |
TogafFunctionalDecompositionDiagramCommande.image = res/bmp/profile/functionaldecompositiondiagram16.png |
| 1096 |
TogafProductLifeCycleDiagramCommande.label = Product Lifecycle diagram |
| 1097 |
TogafProductLifeCycleDiagramCommande.tooltip = Product Lifecycle diagram |
| 1098 |
TogafProductLifeCycleDiagramCommande.image = res/bmp/profile/productlifecyclediagram16.png |
| 1099 |
TogafGoalObjectiveServiceDiagramCommande.label = Driver/Goal/Objectives diagram |
| 1100 |
TogafGoalObjectiveServiceDiagramCommande.tooltip = Driver/Goal/Objectives diagram |
| 1101 |
TogafGoalObjectiveServiceDiagramCommande.image = res/bmp/profile/goalobjectiveservicediagram16.png |
| 1102 |
TogafBusinessUseCaseDiagramCommande.label = Business Use Case diagram |
| 1103 |
TogafBusinessUseCaseDiagramCommande.tooltip = Business Use Case diagram |
| 1104 |
TogafBusinessUseCaseDiagramCommande.image = res/bmp/profile/togafusecasediagram16.png |
| 1105 |
TogafOrganizationRoleDiagramCommande.label = Organization Role diagram |
| 1106 |
TogafOrganizationRoleDiagramCommande.tooltip = Organization Role diagram |
| 1107 |
TogafOrganizationRoleDiagramCommande.image = res/bmp/profile/classhierachydiagram16.png |
| 1108 |
TogafOrganizationDecompositionDiagramCommande.label = Organization Decomposition diagram |
| 1109 |
TogafOrganizationDecompositionDiagramCommande.tooltip = Organization Decomposition diagram |
| 1110 |
TogafOrganizationDecompositionDiagramCommande.image = res/bmp/profile/organizationdecompositiondiagram16.png |
| 1111 |
TogafEventDiagramCommande.label = Event diagram |
| 1112 |
TogafEventDiagramCommande.tooltip = Event diagram |
| 1113 |
TogafEventDiagramCommande.image = res/bmp/profile/togafeventdiagram16.png |
| 1114 |
TogafDataSecurityDiagramCommande.label = Data Security diagram |
| 1115 |
TogafDataSecurityDiagramCommande.tooltip = Data Security diagram |
| 1116 |
TogafDataSecurityDiagramCommande.image = res/bmp/profile/togafdatasecuritydiagram16.png |
| 1117 |
TogafValueChainDiagramCommande.label = Value Chain diagram |
| 1118 |
TogafValueChainDiagramCommande.tooltip = Value Chain diagram |
| 1119 |
TogafValueChainDiagramCommande.image = res/bmp/profile/togafvaluechaindiagram16.png |
| 1120 |
TogafLocationDiagramCommande.label = Location diagram |
| 1121 |
TogafLocationDiagramCommande.tooltip = Location diagram |
| 1122 |
TogafLocationDiagramCommande.image = res/bmp/profile/togaflocationdiagram16.png |
| 1123 |
TogafEnvironmentAndLocationsDiagramCommande.label = Environment and Locations diagram |
| 1124 |
TogafEnvironmentAndLocationsDiagramCommande.tooltip = Environment and Locations diagram |
| 1125 |
TogafEnvironmentAndLocationsDiagramCommande.image = res/bmp/profile/togafenvironmentandlocationsdiagram16.png |
| 1126 |
TogafNewtorkComputingHardwareDiagramCommande.label = Network Computing Hardware diagram |
| 1127 |
TogafNewtorkComputingHardwareDiagramCommande.tooltip = Network Computing Hardware diagram |
| 1128 |
TogafNewtorkComputingHardwareDiagramCommande.image = res/bmp/profile/togafnewtorkcomputinghardwarediagram16.png |
| 1129 |
TogafPlatformDecompositionDiagramCommande.label = Platform decomposition diagram |
| 1130 |
TogafPlatformDecompositionDiagramCommande.tooltip = Platform Decomposition diagram |
| 1131 |
TogafPlatformDecompositionDiagramCommande.image = res/bmp/profile/togafplatformdecompositiondiagram16.png |
| 1132 |
TogafProcessingDiagramCommande.label = Processing diagram |
| 1133 |
TogafProcessingDiagramCommande.tooltip = Processing diagram |
| 1134 |
TogafProcessingDiagramCommande.image = res/bmp/profile/togafprocessingdiagram16.png |
| 1135 |
TogafCommunicationEngineeringDiagramsCommande.label = Communication Engineering diagram |
| 1136 |
TogafCommunicationEngineeringDiagramsCommande.tooltip = Communication Engineering diagram |
| 1137 |
TogafCommunicationEngineeringDiagramsCommande.image = res/bmp/profile/togafcommunicationengineeringdiagrams16.png |
| 1138 |
TogafSofwareDistributionDiagramCommande.label = Software Distribution diagram |
| 1139 |
TogafSofwareDistributionDiagramCommande.tooltip = Software Distribution diagram |
| 1140 |
TogafSofwareDistributionDiagramCommande.image = res/bmp/profile/sofwaredistributiondiagram16.png |
| 1141 |
TogafSofwareDistributionDiagramCommande.preview = res/bmp/profile/softwaredistributionpreview.png |
| 1142 |
TogafMatrixDiagramCommande.label = Traceability diagram |
| 1143 |
TogafMatrixDiagramCommande.tooltip = Traceability diagram |
| 1144 |
TogafMatrixDiagramCommande.image = res/bmp/profile/togafmatrixdiagram16.png |
| 1145 |
|
| 1146 |
Diagrams.group = Togaf diagrams |
| 1147 |
Diagrams.groupimage = res/bmp/profile/togafdiagram16.png |
| 1148 |
TogafPropertyPage.label = Togaf |
| 1149 |
TogafPropertyPage.image = res/bmp/togaf16.png |